Align ABC-type transporter, integral membrane subunit, component of Trehalose porter. Also binds sucrose (Boucher and Noll, 2011). Induced by glucose and trehalose. Directly regulated by trehalose-responsive regulator TreR (characterized)
to candidate Ac3H11_2942 Various polyols ABC transporter, permease component 2
Query= TCDB::G4FGN6 (278 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2942 Length = 279 Score = 137 bits (346), Expect = 2e-37 Identities = 79/254 (31%), Positives = 144/254 (56%), Gaps = 4/254 (1%) Query: 24 FPLYWAFISSIKPDRDLFEKNPSLFPKRITFENYVKVFKERPFHINIKNSIIVAGITTVL 83 FPL W F+++ K + P LF T EN+ +V + + + KNS+I + ++TVL Sbjct: 30 FPLGWLFLTAFKTELQAIAV-PPLFVFTPTLENFHEVQERSDYLLYAKNSVITSVLSTVL 88 Query: 84 ALVVGSLAGYAIARLKFRGKVIVMSLILAVSMFPQVSILGSLFLILRGLKLINTYTGLII 143 L++ + A YA+A K + ++ +L+ M P V L ++++ + L++T LII Sbjct: 89 GLMLAAPAAYAMAFFKGKYTKDILMWMLSTKMMPAVGALVPIYVLAQKSHLLDTQLALII 148 Query: 144 PYTAMNLPLTVWVLQSFFRELPKEVEESAFIDGASKLRTLWSIVLPMSAPGLVATGLLTF 203 + NLP+ VW+L S F+++P E+ E+A +DGA+ + + ++LP+ GL +TGLL Sbjct: 149 VFALSNLPIMVWMLYSHFKDIPHEILEAARMDGATLWQEVRLVLLPLGMGGLASTGLLCL 208 Query: 204 IAAWNEFLFALTFMQKPSLYTVPVAVALFKGASQYEIPWGQLMAAAVIVTLPLVILVLVF 263 + +WNE ++L + T+ +A + +S + W +L AA+++ P+V+ Sbjct: 209 VLSWNEAFWSLN-LSAAKAGTLATLIASY--SSPEGLFWAKLSAASLMAIAPIVVFGWFS 265 Query: 264 QNRIIAGLSAGAVK 277 Q +++ GL+ GAVK Sbjct: 266 QKQLVQGLTFGAVK 279 Lambda K H 0.329 0.142 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 279 Length adjustment: 25 Effective length of query: 253 Effective length of database: 254 Effective search space: 64262 Effective search space used: 64262 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory