Align TreV, component of Trehalose porter (characterized)
to candidate Ac3H11_4785 Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)
Query= TCDB::Q97ZC0 (324 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4785 Length = 334 Score = 247 bits (631), Expect = 3e-70 Identities = 127/301 (42%), Positives = 196/301 (65%), Gaps = 4/301 (1%) Query: 2 TVELIDIVKKYGK----NIVINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKG 57 ++ L +I K+YG N VI+G+ +++ GEF VI+GPSG GKSTLL+++AG+E++ G Sbjct: 3 SLSLRNITKRYGHGPKANQVIHGVNAEVKDGEFVVIVGPSGCGKSTLLRMVAGLEEISGG 62 Query: 58 KIIADGADITDKPPEKRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKAA 117 ++ + D P +R++AMVFQNYALYP+M+ +N+A+ LK+ + K+EI RV+KAA Sbjct: 63 ELRIGDRVVNDLEPAQRDIAMVFQNYALYPHMTNFENMAYGLKIAKVPKDEIKARVDKAA 122 Query: 118 KLLGISEILDKKVTQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGELKR 177 K+L + +L++K ++SGGQ+QRVA+ RAIVR P FL DEPLSNLDA++R R E+++ Sbjct: 123 KILELGHLLERKPRELSGGQRQRVAMGRAIVRQPQVFLFDEPLSNLDAKLRAQTRLEIQK 182 Query: 178 IQKELKGTFIYVTHDQKEALSLADRIAILHKGKFEQVSDPKTLYEYPKTKWVAQFVGEFP 237 + +EL T ++VTHDQ EA++LA R+ +++ G EQ P+ +Y P T +VA F+G P Sbjct: 183 LHRELGITSLFVTHDQVEAMTLAQRMIVMNAGNMEQFGTPEEVYHTPATTFVASFIGSPP 242 Query: 238 MNFLPGELMKEKAQEIGFRPEWVEVGKGNLSCMVESVEASGESRYLICNFKNNNITILSQ 297 MN L + +G RPE ++V + VE+VE G R + + + + Sbjct: 243 MNLLKNAPGAQPGTILGIRPEHLDVRSEGWAVTVETVELLGAERLIYGRINGEQVIVRVE 302 Query: 298 E 298 E Sbjct: 303 E 303 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 334 Length adjustment: 28 Effective length of query: 296 Effective length of database: 306 Effective search space: 90576 Effective search space used: 90576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory