Align electron transfer component of the anthranilate 1,2-dioxygenase system (EC 1.14.12.1) (characterized)
to candidate Ac3H11_209 Ferredoxin reductase
Query= reanno::WCS417:GFF4631 (335 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_209 Length = 328 Score = 145 bits (367), Expect = 1e-39 Identities = 105/316 (33%), Positives = 160/316 (50%), Gaps = 22/316 (6%) Query: 25 LLDAALRNGIKIPLDCREGVCGTCQGRCESGDYSQDYVDEEALSSLDLQQRKMLSCQTRV 84 LLDA + + C G CG C+ R SG+ E LD +L+CQT V Sbjct: 20 LLDALRAAQVPMSYSCLSGRCGICRCRVLSGEVLDG--GREQQRPLDGVDGAVLACQTYV 77 Query: 85 KSDATFYFDFDSSLCNAPGPVQV------KGTVSAVEQVSASTAILQVQLDQALDFLPGQ 138 T APG V K TV A+E ++A L +++ + + + PGQ Sbjct: 78 TEPCTIEVP-------APGEAVVHRARVAKATVVAIEPLAADIRRLLLKVAKPIAYSPGQ 130 Query: 139 YARLSVPGTDSWRSYSFANLPGNHL-QFLVRLLPDGVMSNYLRERCQVGDELLMEAPLGA 197 Y +L T R YS ANLPG L +F ++L+P G +S Y+ + +VGD++ + PLGA Sbjct: 131 YMQLGFTPTHV-RPYSMANLPGEPLLEFHIQLMPQGRVSGYIAGQLKVGDKVKVSGPLGA 189 Query: 198 FYLRHV-TQPLVLVAGGTGLSALLGMLDQLAANGCEQPVHLYYGVRGAEDLCEAARIRAY 256 YLR T P++ VAGGTGL+++L ++ A G P+HLY+G+R +L + Sbjct: 190 AYLRQQHTGPMLCVAGGTGLASVLSVVRGAMAAGMRNPIHLYFGLRSPRELYGLTWLDHL 249 Query: 257 AAKIPNLRYTEVLSAPSEEWSGKRGYLTEHF--DLAELRDGSADMYLCGPPPMVESIQQW 314 + P L+ V+++ ++ + +RG +T+ D A L+ A YLCG PPMVE+ Sbjct: 250 RSVHPALQVHVVVASRADSATQRRGLVTQAIEQDHASLQGWQA--YLCGSPPMVETTTLL 307 Query: 315 LADQALDGVQLYYEKF 330 + L+ L+ E F Sbjct: 308 ALGKGLEAAHLHAEAF 323 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 328 Length adjustment: 28 Effective length of query: 307 Effective length of database: 300 Effective search space: 92100 Effective search space used: 92100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory