Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate Ac3H11_2553 Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)
Query= uniprot:P40735 (281 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2553 Length = 265 Score = 124 bits (311), Expect = 2e-33 Identities = 79/215 (36%), Positives = 121/215 (56%), Gaps = 11/215 (5%) Query: 25 LDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGDIEVAGIQLTEES------- 77 L+G+ V + + ++G +GSGKST R NGL PE G +E+ G L ++ Sbjct: 34 LNGIDFDVLPSQVVVVIGPSGSGKSTFLRCCNGLEQPEGGSVEICGRTLVQDGRMLPDHD 93 Query: 78 VWEVRKKIGMVFQNPDNQFVGTTVRDDVAFGLEN-NGVPREEMIERVDWAVKQVNMQDFL 136 + +R+++GMVFQ+ N F +V D+V G G+ R+E ER + +V + Sbjct: 94 LNALREEVGMVFQS-FNLFPHLSVLDNVTLGPRKLRGLSRKEAEERAQALLTKVGLAHKA 152 Query: 137 DQEPHHLSGGQKQRVAIAGVIAARPDIIILDEATSMLDPIGREEVLETVRHLKEQGMATV 196 P LSGGQKQRVAIA +A P +++ DE TS LDP EVL+ ++ L +GM T+ Sbjct: 153 PAMPASLSGGQKQRVAIARALAMEPRVMLFDEPTSALDPELVGEVLQVMKLLASEGM-TM 211 Query: 197 ISITHDLNEAAK-ADRIIVMNGGKKYAEGPPEEIF 230 + +TH+++ A + D ++VM+GG G P IF Sbjct: 212 MVVTHEMDFAREVGDVVVVMDGGGIIEAGAPATIF 246 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 265 Length adjustment: 25 Effective length of query: 256 Effective length of database: 240 Effective search space: 61440 Effective search space used: 61440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory