Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate Ac3H11_2058 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)
Query= uniprot:P70970 (276 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2058 Length = 360 Score = 135 bits (341), Expect = 1e-36 Identities = 85/215 (39%), Positives = 125/215 (58%), Gaps = 10/215 (4%) Query: 8 LALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNKDL 67 LA+ I+ + G+ ++G +G GK+T L+ + GL PT G+I +G GK L Sbjct: 25 LAVKGISFEVPRGTLTTILGPSGCGKTTTLRMIAGLESPTSGEIFIG------GKDVTTL 78 Query: 68 KKLRKKVGIVFQFPEHQLFEE-TVLKDISFGPMNFGVKKEDAEQKAREMLQLVGLSEELL 126 ++ V ++FQ + LF V++++ +G G KE A KA E L+ VGL Sbjct: 79 GPAQRNVSMMFQ--SYALFPHMNVVENVMYGLRMSGQPKEQARAKAVEALRGVGLVG-FD 135 Query: 127 DRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQRGNLTT 186 DR P ELSGGQ +RVA+A L ++PEVL+ DEP + LD R R+E+ + L QR +LT Sbjct: 136 DRLPSELSGGQQQRVALARALVLEPEVLLFDEPLSNLDARLRREMREEIRALQQRLSLTV 195 Query: 187 ILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLF 221 VTH +A A +D++IVM++G I GSPR L+ Sbjct: 196 AYVTHDQAEAMAVSDQIIVMNQGLIAQKGSPRALY 230 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 360 Length adjustment: 27 Effective length of query: 249 Effective length of database: 333 Effective search space: 82917 Effective search space used: 82917 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory