Align Kynurenine formamidase; KFA; KFase; Arylformamidase; N-formylkynurenine formamidase; FKF; EC 3.5.1.9 (characterized)
to candidate Ac3H11_1158 Kynurenine formamidase, bacterial (EC 3.5.1.9)
Query= SwissProt::P0C8P4 (218 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1158 Length = 217 Score = 250 bits (639), Expect = 1e-71 Identities = 126/214 (58%), Positives = 146/214 (68%), Gaps = 1/214 (0%) Query: 5 PQLHDGRRIWDISPAVSPATPVWPGDTPFQHDPAWQLDEHCPVNVGRITMSPHTGAHADA 64 P RR+WDISP V +PV+PGDT + + CPVNV ITMSPH GAHADA Sbjct: 4 PSSPTARRLWDISPPVHAGSPVFPGDTAYSQQWCATIGPGCPVNVSAITMSPHVGAHADA 63 Query: 65 PLHYAADGAPIGAVPLDAYLGPCRVIHCIGAAPRVEPQHIAHALAGT-PPRVLLRTYAQA 123 PLHY A GA IG V LDA+LGPCRV+H IG P + +HIAHA+ GT P RVL+RTY Sbjct: 64 PLHYDAQGATIGDVSLDAFLGPCRVVHAIGCGPLITWEHIAHAVDGTLPQRVLVRTYEHM 123 Query: 124 PQGKWDSAFCAVAPETISLLARHGVRLIGIDTPSLDPETSKTMDAHHAVRDHQLAILEGI 183 P +WD A AP TI LA GV L+GIDT S+DP SKT+D+H +R L +LE + Sbjct: 124 PVDRWDGQLAAYAPGTIERLADLGVLLVGIDTASIDPADSKTLDSHQVIRRRGLRVLENL 183 Query: 184 VLDEVPAGDYELIALPLRLATLDASPVRAVLREL 217 VLD VP GDYELIALPL+L T DASPVRAVLR L Sbjct: 184 VLDAVPEGDYELIALPLKLTTADASPVRAVLRAL 217 Lambda K H 0.320 0.137 0.444 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 218 Length of database: 217 Length adjustment: 22 Effective length of query: 196 Effective length of database: 195 Effective search space: 38220 Effective search space used: 38220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
Align candidate Ac3H11_1158 (Kynurenine formamidase, bacterial (EC 3.5.1.9))
to HMM TIGR03035 (kynB: arylformamidase (EC 3.5.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03035.hmm # target sequence database: /tmp/gapView.25615.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03035 [M=206] Accession: TIGR03035 Description: trp_arylform: arylformamidase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-92 295.6 0.0 1.3e-92 295.4 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1158 Kynurenine formamidase, bacteria Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1158 Kynurenine formamidase, bacterial (EC 3.5.1.9) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 295.4 0.0 1.3e-92 1.3e-92 1 206 [] 11 217 .] 11 217 .] 0.99 Alignments for each domain: == domain 1 score: 295.4 bits; conditional E-value: 1.3e-92 TIGR03035 1 rlidisqplnedlatwPGdtpfsqelavsleeegsvnvgritlsvhtGahvdaPlhykndga 62 rl+dis+p+++ ++++PGdt++sq++ +++ + ++vnv+ it+s+h+Gah+daPlhy+++ga lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1158 11 RLWDISPPVHAGSPVFPGDTAYSQQWCATIGPGCPVNVSAITMSPHVGAHADAPLHYDAQGA 72 68************************************************************ PP TIGR03035 63 kigdveldvylGpcrvidclsalekiekealksalee.apervllrtaekakaeafdediaa 123 igdv+ld++lGpcrv++++++ ++i+ e++++a+++ +p+rvl+rt+e+++ +++d ++aa lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1158 73 TIGDVSLDAFLGPCRVVHAIGCGPLITWEHIAHAVDGtLPQRVLVRTYEHMPVDRWDGQLAA 134 **********************************9973699********************* PP TIGR03035 124 vapdtiellaekGvrliGvdtpsvdPleskeldahhalakhdlailenlvldevaeGdyeli 185 +ap tie la Gv l+G+dt+s+dP++sk+ld+h+ +++++l++lenlvld v eGdyeli lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1158 135 YAPGTIERLADLGVLLVGIDTASIDPADSKTLDSHQVIRRRGLRVLENLVLDAVPEGDYELI 196 ************************************************************** PP TIGR03035 186 alPlklaeldaspvravlral 206 alPlkl+++daspvravlral lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1158 197 ALPLKLTTADASPVRAVLRAL 217 *******************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (206 nodes) Target sequences: 1 (217 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.59 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory