Align 2-keto-4-pentenoate hydratase 2; EC 4.2.1.80; 2-hydroxypentadienoic acid hydratase 2 (uncharacterized)
to candidate Ac3H11_1487 5-carboxymethyl-2-oxo-hex-3- ene-1,7-dioate decarboxylase (EC 4.1.1.68) / 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (EC 5.3.3.-)
Query= curated2:Q49KF9 (270 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1487 Length = 255 Score = 46.2 bits (108), Expect = 7e-10 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 5/73 (6%) Query: 185 MRMSKNGEVVSSGSGGECLGNPLNAAVWLARTMAEFGEPLKAGDIILTGALGPMVGVSAG 244 +R NG+VV G G + + +L+ M L+AGD+ILTG +V VS G Sbjct: 176 LRTLVNGQVVQQGHTGNMVNDIAELIEYLSGFMT-----LRAGDVILTGTPEGVVNVSVG 230 Query: 245 DHFEAEIEGLGRV 257 D EI+G+GR+ Sbjct: 231 DQVVTEIDGIGRL 243 Lambda K H 0.317 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 270 Length of database: 255 Length adjustment: 25 Effective length of query: 245 Effective length of database: 230 Effective search space: 56350 Effective search space used: 56350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory