Align 2-oxopent-4-enoate hydratase subunit (EC 4.2.1.80) (characterized)
to candidate Ac3H11_4809 2-oxo-hepta-3-ene-1,7-dioic acid hydratase (EC 4.2.-.-)
Query= metacyc::MONOMER-3403 (222 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4809 Length = 271 Score = 153 bits (386), Expect = 3e-42 Identities = 94/230 (40%), Positives = 130/230 (56%), Gaps = 11/230 (4%) Query: 1 MDKTLINELGDELYQAMVQRETVTPLTSRGFDISVEDAYHISLRMLERRLAAGERVIGKK 60 +D LI +L EL+QA R V + R ++V+D Y IS + ++A G V G K Sbjct: 2 LDDALIQQLASELHQAEKTRVQVEHFSKRHPGMTVQDGYAISRAWVAMKIAEGRTVRGHK 61 Query: 61 IGVTSKAVQNMLGVHQPDFGYLTDAMVYNSGEAMPISEKLIQPRAEGEIAFILKKDLMG- 119 IG+TS+A+Q + +PDFG L D M + G +P+ ++ I PR E E+AF+L K L G Sbjct: 62 IGLTSRAMQVASQITEPDFGTLLDDMFFAEGCDIPM-QRFILPRVEVELAFVLHKPLRGE 120 Query: 120 ---PGVTNADVLAATECVIPCFEVVDSRIQD------WKIKIQDTVADNASCGLFVLGDQ 170 P V DVLAATE V+P E++D+RI+ K+ DT++DNA+ V G + Sbjct: 121 PGRPPVNIFDVLAATEYVVPAIEIIDARIEQHDRHTGGMRKVFDTISDNAANAGIVTGGR 180 Query: 171 AVSPRQVDLVTCGMLVEKNGQLLSTGAGAAALGSPVNCVAWLANTLGHFG 220 V P VDL CG L+ KNG + +G AA L P VAWLAN L +G Sbjct: 181 PVRPDAVDLRWCGALLYKNGVIEESGLAAAVLNHPATGVAWLANKLAPYG 230 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 271 Length adjustment: 24 Effective length of query: 198 Effective length of database: 247 Effective search space: 48906 Effective search space used: 48906 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory