Align 2-amino-5-chloromuconic acid deaminase; 2-aminomuconate deaminase; EC 3.5.99.5 (characterized)
to candidate Ac3H11_417 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases
Query= SwissProt::Q38M35 (462 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_417 Length = 451 Score = 208 bits (529), Expect = 3e-58 Identities = 147/396 (37%), Positives = 205/396 (51%), Gaps = 28/396 (7%) Query: 70 PLMGLPVSVKDLYGVPGLPVFAGSDEALPEAWQAAG--PLVARLQRQLGIVVGKTHTVEF 127 PL GL VSVKDL+ + G AGS AL +A AA P VARL+ ++G+T+ VEF Sbjct: 60 PLAGLAVSVKDLFDIAGQATPAGST-ALADAPAAAQDCPAVARLRAAGASLIGRTNMVEF 118 Query: 128 AFGGLGVNAHWGTP-----RNPWSPHEHRVPGGSSAGAGVSLVQGSALLALGTDTAGSVR 182 AF G+GVN H GTP R+ P RVPGGSS+GAGVS+ G+A + LG+DT GS+R Sbjct: 119 AFSGVGVNPHHGTPAAWDARSGALPGAPRVPGGSSSGAGVSVATGAAFIGLGSDTGGSIR 178 Query: 183 VPASMTGQVGLKTTVGRWPVEGIVPLSSSLDTAGVLTRTVEDLAYAFAALDTESQGLPAP 242 +PA++ G VG K T P G VPLS++LDTA +TR+V D A L + + Sbjct: 179 IPAALNGIVGFKNTAHLVPTTGAVPLSTTLDTACAMTRSVRDAIVAHEVL-AARRVTRSL 237 Query: 243 APVRVQGLRVGVPTNHFWDDIDPSIAAAVEAAVQRLAQAGAQVVRFPLPHCEEAFDIFRR 302 AP + R+ VP+ F D +D ++A A E ++ L QAGA + PLP E Sbjct: 238 AP--LSQYRLAVPSTLFLDGLDATVAQAFERTLRTLRQAGAHIDTIPLPAVAEQ----PA 291 Query: 303 GGLAASELAAYLDQHFPHKVERLDPVVRDRVRWAEQVSSVEYLRRKAVLQRCGAGAARLF 362 G AA E A+ + R DP VR R+ + + EY+ Q+ A Sbjct: 292 YGFAAPEAYAWHRELLQRAGNRYDPRVRMRIEKGATLMAWEYIDLLQARQQWIARMLADM 351 Query: 363 DDVDVLLTPTVPASPPRLADIGTVE------------TYAPANMKAMRNTAISNLFGWCA 410 + D LL+PTVP P +AD+ + + N +RNT++ NL CA Sbjct: 352 EPYDTLLSPTVPIVAPLVADVAPADGTDKARDAARDAEFFRVNNLLLRNTSVVNLLDGCA 411 Query: 411 LTMPVGLDANRMPVGLQLMGPPRAEARLIGIALGIE 446 L++P +PVGL + + ++ + L IE Sbjct: 412 LSLPCHA-PGELPVGLMVWHGALRDDTVLNVGLQIE 446 Lambda K H 0.320 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 547 Number of extensions: 31 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 462 Length of database: 451 Length adjustment: 33 Effective length of query: 429 Effective length of database: 418 Effective search space: 179322 Effective search space used: 179322 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory