Align 2-oxo-3-hexenedioate decarboxylase (EC 4.1.1.77) (characterized)
to candidate Ac3H11_4809 2-oxo-hepta-3-ene-1,7-dioic acid hydratase (EC 4.2.-.-)
Query= metacyc::MONOMER-15110 (260 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4809 Length = 271 Score = 172 bits (436), Expect = 7e-48 Identities = 105/267 (39%), Positives = 147/267 (55%), Gaps = 11/267 (4%) Query: 1 MDKTVIKDLARFLVDAEVEKKEVLKLTNEHPDLTVEDGYAIQEQLVQMKLEQGYRIVGPK 60 +D +I+ LA L AE + +V + HP +TV+DGYAI V MK+ +G + G K Sbjct: 2 LDDALIQQLASELHQAEKTRVQVEHFSKRHPGMTVQDGYAISRAWVAMKIAEGRTVRGHK 61 Query: 61 MGLTSQAKMKQMNVNEPIYGYIFDYMV-VNGQELSMSELIHPKVEAEIAFILGKDIEG-- 117 +GLTS+A + EP +G + D M G ++ M I P+VE E+AF+L K + G Sbjct: 62 IGLTSRAMQVASQITEPDFGTLLDDMFFAEGCDIPMQRFILPRVEVELAFVLHKPLRGEP 121 Query: 118 --PGITGAQVLAATEYVVPALEIIDSRYQNFQF------TLPDVIADNASSSRVFLGSTI 169 P + VLAATEYVVPA+EIID+R + + D I+DNA+++ + G Sbjct: 122 GRPPVNIFDVLAATEYVVPAIEIIDARIEQHDRHTGGMRKVFDTISDNAANAGIVTGGRP 181 Query: 170 KRPDNMELDLLGVTLSINGQIKDLGAGAAVVGHPANSVAMLANMLARKGLKLKAGQIILS 229 RPD ++L G L NG I++ G AAV+ HPA VA LAN LA G L AG+++L Sbjct: 182 VRPDAVDLRWCGALLYKNGVIEESGLAAAVLNHPATGVAWLANKLAPYGEGLAAGEVVLG 241 Query: 230 GGITGAVMLNVGDSVTGKFDGLGTIDF 256 G T V GD+ + LG I F Sbjct: 242 GSFTRPVSAAAGDTFHADYGPLGNIAF 268 Lambda K H 0.317 0.137 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 271 Length adjustment: 25 Effective length of query: 235 Effective length of database: 246 Effective search space: 57810 Effective search space used: 57810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory