Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate Ac3H11_3317 Glutathione S-transferase, unnamed subgroup (EC 2.5.1.18)
Query= reanno::acidovorax_3H11:Ac3H11_2306 (222 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3317 Length = 213 Score = 52.8 bits (125), Expect = 5e-12 Identities = 59/211 (27%), Positives = 87/211 (41%), Gaps = 21/211 (9%) Query: 1 MQLYNYFRSSASFRVRIALQIKGLAYDYLPVHLVKGEHKAPEYASRIGDALVPTLVTDGG 60 +QLY S RV + L + GL Y+ + V+L++GEH+ E+ + VP LV D G Sbjct: 7 LQLYRMPISGHCHRVELMLCLLGLPYELIDVNLLRGEHQRAEFLALNPLGQVPVLV-DAG 65 Query: 61 TALSQSMAIIEYLDETH-PTPALLPATPLARARVRALAQMVACEIHP-INNLRVLKYLVR 118 LS S I+ YL + + P A LP + +A+++ + A + P I R + Sbjct: 66 QVLSDSNGILVYLVQRYAPGSAWLPQDAVGQAQLQRWFSLAAGFLAPGIGGPRFA--TLN 123 Query: 119 DLKVDEDAKNAWYRHWVRSGLEAFERQFALLAQERAAQGLAPSVLCWGDTPTLADCCLVP 178 V+E A+ R L E QG A L G P+LAD +V Sbjct: 124 GRAVNEVAQATGKR--------------LLAFMEDELQGRA--WLLGGPAPSLADVAMVS 167 Query: 179 QIFNGQRFNVNLDGLPLTMGAFEACMALPAF 209 + LD P ALP + Sbjct: 168 YTSQAHLAGLPLDAYPRIAAWVARMQALPGY 198 Lambda K H 0.323 0.136 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 109 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 222 Length of database: 213 Length adjustment: 22 Effective length of query: 200 Effective length of database: 191 Effective search space: 38200 Effective search space used: 38200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory