Align 2-methylbutanoyl-CoA dehydrogenase / butanoyl-CoA dehydrogenase / isobutyryl-CoA dehydrogenase (EC 1.3.8.1; EC 1.3.8.5) (characterized)
to candidate Ac3H11_2359 Butyryl-CoA dehydrogenase (EC 1.3.99.2)
Query= reanno::pseudo3_N2E3:AO353_25680 (375 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2359 Length = 388 Score = 307 bits (786), Expect = 4e-88 Identities = 166/374 (44%), Positives = 236/374 (63%), Gaps = 3/374 (0%) Query: 4 TDEQLQISDAARQFAQERLKPFAAEWDREHRFPKEAIGEMAELGFFGMLVPEQWGGCDTG 63 T+EQ + AR FAQ P AA WD E FPKEAI + ELGF G+ PE GG Sbjct: 6 TEEQRAFAQTARDFAQAEFAPHAAHWDEEGIFPKEAIAKAGELGFCGLYAPEAAGGLALP 65 Query: 64 YLAYAMALEEIAAGDGACSTIMSVHNSVGCVPILKFGNDDQKERFLKPLASGAMLGAFAL 123 L + EE+AA D + + +++HN + + + ++ + L +G L ++ L Sbjct: 66 RLDATLVFEEMAAVDPSTTAFITIHNMATWM-LGTWATPAVRDHWGPLLTTGEKLASYCL 124 Query: 124 TEPQAGSDASSLKTRARLNGDHYVLNGCKQFITSGQNAGVVIVFAVT-DPSAGKRGISAF 182 TEP AGSDA+SLKTRA L G+ YV+NG K FI+ + V+++ A T D +G GISAF Sbjct: 125 TEPGAGSDAASLKTRAELVGNEYVINGAKAFISGAGSTDVLVLMARTGDAQSGASGISAF 184 Query: 183 IVPTDSPGYKVARVEDKLGQHASDTCQILFEDVQVPVANRLGEEGEGYKIALANLEGGRV 242 VP D+PG + E K+G ++ T I F++V++P + LG EGEG+KIA+ L+GGR+ Sbjct: 185 AVPADAPGISYGKKEQKMGWNSQPTRTISFDNVRIPADHLLGREGEGFKIAMKGLDGGRI 244 Query: 243 GIASQSVGMARAAFEAARDYARERESFGKPIIEHQAVAFRLADMATQIAVARQMVHYAAA 302 IA+ SVG A+ A AA+ Y ++R+ FGKPI QA+ F+LADMAT++ ARQMV AA+ Sbjct: 245 NIATCSVGAAQGALNAAQQYMQDRKQFGKPIASFQALQFKLADMATELVAARQMVRLAAS 304 Query: 303 LRDSG-KPALVEASMAKLFASEMAEKVCSTALQTLGGYGYLSDFPLERIYRDVRVCQIYE 361 D+G + A +MAK FA++ V + ALQ GGYGY+ ++PLER+ RD RV QI E Sbjct: 305 KLDAGARDASTYCAMAKRFATDAGFTVINDALQLHGGYGYIREYPLERLLRDARVHQILE 364 Query: 362 GTSDIQRMVISRNL 375 GT++I R++I+R + Sbjct: 365 GTNEIMRVIIARRM 378 Lambda K H 0.319 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 388 Length adjustment: 30 Effective length of query: 345 Effective length of database: 358 Effective search space: 123510 Effective search space used: 123510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory