Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate Ac3H11_4006 Enoyl-CoA hydratase (EC 4.2.1.17)
Query= BRENDA::Q9LKJ1 (378 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4006 Length = 259 Score = 90.9 bits (224), Expect = 4e-23 Identities = 61/201 (30%), Positives = 99/201 (49%), Gaps = 24/201 (11%) Query: 5 MASQSQVLVEEKSSVRILTLNRPKQLNALSFHMISRLLQLFLAFEEDPSVKLVILKGHGR 64 MA ++ + E V ++TLNRPKQLNAL+ +++ L AF+ D ++ +I+ G + Sbjct: 1 MAYETIEVRVEADKVGVITLNRPKQLNALNDQLMNELGAALKAFDADENIGCMIVTGSEK 60 Query: 65 AFCAGGDVAAVVRDINQGNWRLGANYFSSEYMLNYVMATYS------KAQVSILNGIVMG 118 AF AG D+ A+ + F+ Y +Y+ + K ++ ++G +G Sbjct: 61 AFAAGADIGAMAK-----------YSFADTYKGDYITRNWETIRSIRKPVIAAVSGFALG 109 Query: 119 GGAGVSVHGRFRIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEY----VGLTGAR 174 GG +++ F IA +N F PE LG+ P G + RLP G+ + LTG Sbjct: 110 GGCELAMMCDFIIAADNARFGQPEIKLGVIPGAGGT---QRLPRAVGKSKAMDMALTGRM 166 Query: 175 LDGAEMLACGLATHFVPSTRL 195 +D AE GL + VP +L Sbjct: 167 MDAAEAERAGLVSRVVPYDKL 187 Lambda K H 0.321 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 259 Length adjustment: 27 Effective length of query: 351 Effective length of database: 232 Effective search space: 81432 Effective search space used: 81432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory