Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate Ac3H11_1432 High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)
Query= TCDB::Q8DQI0 (292 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1432 Length = 294 Score = 166 bits (419), Expect = 8e-46 Identities = 93/285 (32%), Positives = 168/285 (58%), Gaps = 5/285 (1%) Query: 4 MLQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDIYMMGAFIGYFLINSFQMNFFV 63 +L QL+ GL+ GS YA+L+LG +++G++ +INFAHG ++M GA I + +N +N+++ Sbjct: 11 LLSQLLLGLVNGSFYAILSLGLAVIFGLLNVINFAHGALFMTGALITWMAMNYLGINYWL 70 Query: 64 ALIVAMLATAILGVVIEFLAYRPLRHSTRIAVLITAIGVSFLLE--YGMVYLVGANTRAF 121 L++A L + GV+IE L R + + L+ +G++ L+E + +Y V Sbjct: 71 MLVLAPLVVGLFGVLIERLLLRWIYKLDHLYGLLLTLGLTLLIEGVFRSIYGVSGLGYDT 130 Query: 122 PQAIQTVRYDLGPISLTNVQLMILGISLILMILLQVIVQKTKMGKAMRAVSVDSDAAQLM 181 P+ ++ +LG + + N + ++ S+++ + +++KTK+G +RA + + + Sbjct: 131 PELLEGAT-NLGFMIMPNYRAWVVVASIVVCVATWYVIEKTKLGAYLRAGTENPRLVEAF 189 Query: 182 GINVNRTISFTFALGSALAGAAGVLIALYYNSLEPLMGVTPGLKSFVAAVLGGIGIIPGA 241 GINV ++ T+A G+ALA AGVL A Y + PLMG + F V+GG+G I G+ Sbjct: 190 GINVPVMVTLTYAFGAALAAFAGVLAAPVY-QVTPLMGQNLIIVVFAVVVIGGMGSIMGS 248 Query: 242 ALGGFVIGLLETFATAFGMSDFRDAIVYGILLLILIVRPAGILGK 286 L G +G++E F F + +V+ I++++L++RPAG+ GK Sbjct: 249 ILTGLGLGVIEGFTKVF-YPEASSTVVFVIMVIVLLIRPAGLFGK 292 Lambda K H 0.330 0.146 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 294 Length adjustment: 26 Effective length of query: 266 Effective length of database: 268 Effective search space: 71288 Effective search space used: 71288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory