Align Methylmalonate-semialdehyde dehydrogenase (EC 1.2.1.27) (characterized)
to candidate Ac3H11_1496 Aldehyde dehydrogenase (EC 1.2.1.3)
Query= reanno::pseudo1_N1B4:Pf1N1B4_1229 (505 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1496 Length = 500 Score = 243 bits (621), Expect = 9e-69 Identities = 154/444 (34%), Positives = 239/444 (53%), Gaps = 13/444 (2%) Query: 10 QKVKLLIDGEWVESQTTEWHDIVNPATQQVLAKVPFATAAEVDAAISAAHRAFQT--WKL 67 ++V +I G + + W + +PAT+ V+A+ P + AA++ A+++A RAF + W+ Sbjct: 20 RRVGNVIGGVSGPALSGRWLPVTDPATEMVVAEAPDSDAADIARAVASAQRAFDSHVWRG 79 Query: 68 TPIGARMRIMLKLQALIREHSKRIAVVLSNEQGKTIADAEG-DIFRGLEVVEHACSIGSL 126 R +++ +L LI H+ ++ + + + GK A D+ G E V + + Sbjct: 80 LRPADREKLLFRLSELIERHADELSALETLQSGKLQGIARAIDVQAGAEFVRYMAGWATK 139 Query: 127 QMGEFAEN---VAGGV-DTYTLRQPIGVCAGITPFNFPAMIPLWMFPMAIACGNTFVLKP 182 G+ +N + G TYT R+P+GV I P+NFP I LW A+A G T VLKP Sbjct: 140 LEGQTLDNSIPIPGPQWVTYTRREPVGVVGAIVPWNFPLAIALWKIAPALAAGCTVVLKP 199 Query: 183 SEQDPMSTMLLVELAIEAGIPPGVLNVVHG-GKDVVDALCTHKDIKAVSFVGSTAVGTHV 241 SE P++ + L LA+EAGIP GVLNVV G G AL H ++ +SF GSTAVG V Sbjct: 200 SEDTPLTALRLAHLALEAGIPEGVLNVVCGRGATAGAALIAHPGVRKLSFTGSTAVGKVV 259 Query: 242 YDLAGKHGKRVQSMMGAKNHAVVLPDANREQALNALVGAGFGAAGQRCMATS-VVVLVGA 300 A ++ R +G K+ AVV+ DA+ Q + F GQ C A+S ++V Sbjct: 260 GHAAVENMARFTLELGGKSPAVVMEDADPSQVAQGIATGIFFHQGQVCTASSRLLVHRSL 319 Query: 301 AKQWLPDLKALAQKLKVNAGSEPGTDVGPVISKRAKARILDLIESGIKEGAKLELDGRDI 360 ++ L +L +AQ +++ +G + T GP+ SK AR++D I S EGA L G + Sbjct: 320 YRRVLDELAGIAQGMRIGSGFDAATQFGPLTSKAHFARVMDFIASAKAEGATLVAGGERV 379 Query: 361 SVPGYEKGNFVGPTLFSGVTPEMQIYTQEIFGPVLVVLEVDTLDQAIALVNANPFGNGTG 420 ++ G FV PT+F+ T +M++ +E+FGPVL V D ++ AIA N P+G Sbjct: 380 ----HDAGCFVQPTIFADTTAQMRVVREEVFGPVLAVAPFDDVEDAIAAANDTPYGLAAS 435 Query: 421 LFTQSGAAARKFQTEIDVGQVGIN 444 L+TQS + A + + G V +N Sbjct: 436 LWTQSLSHAHRIVPRLQAGVVWVN 459 Lambda K H 0.319 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 573 Number of extensions: 30 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 505 Length of database: 500 Length adjustment: 34 Effective length of query: 471 Effective length of database: 466 Effective search space: 219486 Effective search space used: 219486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory