Align 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (characterized)
to candidate Ac3H11_2362 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)
Query= SwissProt::P28811 (298 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2362 Length = 294 Score = 365 bits (936), Expect = e-106 Identities = 194/290 (66%), Positives = 218/290 (75%), Gaps = 2/290 (0%) Query: 4 IAFLGLGNMGGPMAANLLKAGHRVNVFDLQPKAVLGLVEQGAQGADSALQCCEGAEVVIS 63 IAF+GLGNMGGPMA NL KAGH V FDL A L G A A GAEVVIS Sbjct: 3 IAFIGLGNMGGPMAHNLHKAGHEVRAFDLSQPARDKLAADGVPIATDAKAAVAGAEVVIS 62 Query: 64 MLPAGQHVESLYLGDDGLLARVAGKPLLIDCSTIAPETARKVAEAAAAKGLTLLDAPVSG 123 MLPA QHVE L+LG LLA++ L+IDCSTIA T+RKVA+AA AKG+ +DAPVSG Sbjct: 63 MLPASQHVEGLFLGAGELLAQLPAGTLIIDCSTIAAATSRKVADAAKAKGVAFIDAPVSG 122 Query: 124 GVGGARAGTLSFIVGGPAEGFARARPVLENMGRNIFHAGDHGAGQVAKICNNMLLGILMA 183 G GGA AGTL+F+VGG A RARPVLE MG NIFHAG GAGQ AKICNNMLLGILMA Sbjct: 123 GTGGAIAGTLTFMVGGDAADLERARPVLEKMGANIFHAGSVGAGQTAKICNNMLLGILMA 182 Query: 184 GTAEALALGVKNGLDPAVLSEVMKQSSGGNWALNLYNPWPGVMPQAPASNGYAGGFQVRL 243 GT+EA+ALGV NGLDP VLSE+M++SSGGNWAL YNP+PGVM APAS GYAGGF L Sbjct: 183 GTSEAIALGVANGLDPKVLSEIMRRSSGGNWALEKYNPFPGVMEXAPASKGYAGGFGTDL 242 Query: 244 MNKDLGLALANAQAVQASTPLGALARNLFSLHAQADAEHEGLDFSSIQKL 293 M KDLGLA NA AV+A+TPLG +ARNL++ H+ A H GLDFSSI K+ Sbjct: 243 MLKDLGLAQENAMAVKAATPLGGMARNLYAAHSLAG--HGGLDFSSIIKM 290 Lambda K H 0.317 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 294 Length adjustment: 26 Effective length of query: 272 Effective length of database: 268 Effective search space: 72896 Effective search space used: 72896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate Ac3H11_2362 (3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31))
to HMM TIGR01692 (mmsB: 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01692.hmm # target sequence database: /tmp/gapView.27217.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01692 [M=288] Accession: TIGR01692 Description: HIBADH: 3-hydroxyisobutyrate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-130 419.8 11.5 3.3e-130 419.6 11.5 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2362 3-hydroxyisobutyrate dehydrogena Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2362 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 419.6 11.5 3.3e-130 3.3e-130 1 287 [. 5 291 .. 5 292 .. 1.00 Alignments for each domain: == domain 1 score: 419.6 bits; conditional E-value: 3.3e-130 TIGR01692 1 fiGlGnmGgpmaanllkaghavrvfdlsakaveelveaGaqaaasaaeaveeadvvitmlPa 62 fiGlGnmGgpma+nl kagh+vr+fdls a ++l ++G+ +a+ a++av++a+vvi+mlPa lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2362 5 FIGLGNMGGPMAHNLHKAGHEVRAFDLSQPARDKLAADGVPIATDAKAAVAGAEVVISMLPA 66 9************************************************************* PP TIGR01692 63 gkhvesvyagdegilakvkkksllidsstidvdsarkvaeeaaakGavfldaPvsGGvggar 124 ++hve +++g+ ++la++ ++l+id+sti++ ++rkva++a+akG f+daPvsGG+gga lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2362 67 SQHVEGLFLGAGELLAQLPAGTLIIDCSTIAAATSRKVADAAKAKGVAFIDAPVSGGTGGAI 128 ************************************************************** PP TIGR01692 125 aGtltfmvGgeaeefaraepvleamgknivhaGdaGaGqaakiCnnlllgismiGvaealal 186 aGtltfmvGg a++++ra+pvle mg ni+haG +GaGq+akiCnn+llgi m+G++ea+al lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2362 129 AGTLTFMVGGDAADLERARPVLEKMGANIFHAGSVGAGQTAKICNNMLLGILMAGTSEAIAL 190 ************************************************************** PP TIGR01692 187 geklGldpkvlaeilskssGrcWsldtynPvPGvveqaPasngykgGfatalmlkdlglaqe 248 g+++Gldpkvl+ei+++ssG +W+l+ ynP+PGv+e aPas+gy+gGf+t+lmlkdlglaqe lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2362 191 GVANGLDPKVLSEIMRRSSGGNWALEKYNPFPGVMEXAPASKGYAGGFGTDLMLKDLGLAQE 252 ************************************************************** PP TIGR01692 249 aaksvkasvllGalarelyslfaskgagkkdfsavikll 287 +a +vka ++lG +ar+ly++++ +g+g++dfs++ik++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2362 253 NAMAVKAATPLGGMARNLYAAHSLAGHGGLDFSSIIKMV 291 ************************************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (288 nodes) Target sequences: 1 (294 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.76 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory