Align 3-hydroxyisobutyrate dehydrogenase subunit (EC 1.1.1.31) (characterized)
to candidate Ac3H11_4470 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)
Query= metacyc::MONOMER-11664 (295 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4470 Length = 304 Score = 159 bits (401), Expect = 1e-43 Identities = 99/293 (33%), Positives = 151/293 (51%), Gaps = 12/293 (4%) Query: 2 RIAFIGLGNMGAPMARNLIKAGHQLNLFDLNKTV-LAELAELGGQISP----SPKDAAAN 56 ++AF+GLG MG PMA +L AGH++ +++ T +A AE G +P +P++AAA Sbjct: 16 KVAFLGLGVMGYPMAGHLALAGHEVTVYNRTATKSVAWCAEYAGAKAPKHATTPREAAAG 75 Query: 57 SELVITMLPAAAHVRSVYLNDDGVLAGIRPGTPTVDCSTIDPQTARDVSKAAAAKGVDMG 116 +++V + +RSV L DG AG++PG VD +T + AR++ AA A G+ Sbjct: 76 ADIVFCCVGNDNDLRSVTLGADGAFAGMQPGAIFVDHTTASAEVARELYAAAKALGLQFV 135 Query: 117 DAPVSGGTGGAAAGTLTFMVGASAELFASLKPVLEQMGRNIVHCGEVGTGQIAKICNNLL 176 DAPVSGG GA G LT M G A F + +PV R GE G+GQ+AK+ N + Sbjct: 136 DAPVSGGQAGAQNGQLTVMCGGDAAAFDAAQPVATAFSRAFTLLGESGSGQLAKMVNQIC 195 Query: 177 LGISMIGVSEAMALGNALGIDTKVLAGIINSSTGRCWSSDTYNPWPGIIETAPASRGYTG 236 + + G+SEA+A G G+D K + +I + W D + Sbjct: 196 IAGLVQGLSEAVAFGQNAGLDMKQVLDVIGKGAAQSWQMDNRG-------KTMVDGKFDF 248 Query: 237 GFGAELMLKDLGLATEAARQAHQPVILGAVAQQLYQAMSLRGEGGKDFSAIVE 289 GF + M KDLGL + A++ V + A+ Q Y + G D S++++ Sbjct: 249 GFAVDWMRKDLGLVLDEAKRNGSRVPVTALVDQFYADVQQMGGNRWDTSSLIK 301 Lambda K H 0.317 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 304 Length adjustment: 27 Effective length of query: 268 Effective length of database: 277 Effective search space: 74236 Effective search space used: 74236 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory