Align ABC transporter for Xylitol, permease component 2 (characterized)
to candidate Ac3H11_2942 Various polyols ABC transporter, permease component 2
Query= reanno::Dino:3607127 (272 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2942 Length = 279 Score = 186 bits (472), Expect = 5e-52 Identities = 87/250 (34%), Positives = 153/250 (61%) Query: 23 FPFYWMVTTSLKTQIVALEAPPVWIFEPTLSNYREALFEDGVLRTLINSLIIAISTTFLA 82 FP W+ T+ KT++ A+ PP+++F PTL N+ E L NS+I ++ +T L Sbjct: 30 FPLGWLFLTAFKTELQAIAVPPLFVFTPTLENFHEVQERSDYLLYAKNSVITSVLSTVLG 89 Query: 83 LVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIVLALPFFLIARNLGLLDKHITLILI 142 L+L PAA+A+A F+ + KD+ W ++ +M+ + +P +++A+ LLD + LI++ Sbjct: 90 LMLAAPAAYAMAFFKGKYTKDILMWMLSTKMMPAVGALVPIYVLAQKSHLLDTQLALIIV 149 Query: 143 YLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFTIMRKICLPLAMPGVAVSAIFSFI 202 + NLPI++W++ F+ IP+++ EAAR++GA+ + +R + LPL M G+A + + + Sbjct: 150 FALSNLPIMVWMLYSHFKDIPHEILEAARMDGATLWQEVRLVLLPLGMGGLASTGLLCLV 209 Query: 203 FSWNELMFGLILTRSEAKTAPAMAVSFMEGYNLPYGKIMATSTLIVIPVLIFALIASKQL 262 SWNE + L L+ ++A T + S+ L + K+ A S + + P+++F + KQL Sbjct: 210 LSWNEAFWSLNLSAAKAGTLATLIASYSSPEGLFWAKLSAASLMAIAPIVVFGWFSQKQL 269 Query: 263 VRGLTMGAVK 272 V+GLT GAVK Sbjct: 270 VQGLTFGAVK 279 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 279 Length adjustment: 25 Effective length of query: 247 Effective length of database: 254 Effective search space: 62738 Effective search space used: 62738 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory