Align Putative xylitol transport system substrate-binding protein; SubName: Full=Sugar ABC transporter substrate-binding protein (characterized, see rationale)
to candidate Ac3H11_611 Putative sugar ABC transport system, periplasmic binding protein YtfQ precursor
Query= uniprot:A0A1N7UEK0 (335 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_611 Length = 322 Score = 118 bits (295), Expect = 2e-31 Identities = 80/263 (30%), Positives = 134/263 (50%), Gaps = 10/263 (3%) Query: 1 MKLGTTLAATAALSLLACSIAMAADGKTYKVGAAVYGLKGQFMQNWVRELKEHPAVKDGT 60 M T AA A++ + A + A K +G + G + ++ +K A K+ Sbjct: 4 MNRRTVAAALASVPVAALLPSTAWAQKPLVLGFSQVGAESEWRTANTESIKS--AAKEAG 61 Query: 61 VQLTVFDGNYDALTQNNQIENMVTQRYDAILFVPIDTKAGVGTVKAAMSNDVVVI----A 116 ++L D Q I + + Q+ D I F P+ ++ A + + V+ A Sbjct: 62 IELKFSDAQQKQENQIKAIRSFIAQKVDVIAFSPVVESGWEPVLREAKAAKIPVVLTDRA 121 Query: 117 SNTKVADASVPYVGNDDVEGGRLQAQAMVDKLN---GKGNVVIIQGPIGQSAQIDREKGE 173 NTK V ++G+D VE GR + +V+K+ G+ N+V +QG +G + IDR+KG Sbjct: 122 VNTKDTSLYVTFMGSDFVEEGRKAGRWLVEKMKDQKGEVNIVELQGTVGSAPAIDRKKGF 181 Query: 174 LEVLGKHPDIKIIEKKTANWDRAQALALTEDWLNAHPKGINGVIAQNDDMALGAVQALKS 233 E++ P KII +T ++ RA+ + E +L A K IN + A NDDMA+GA+QA++ Sbjct: 182 EEIIKADPKFKIIRSQTGDFTRAKGKEVMEAFLKAEGKKINVLYAHNDDMAIGAIQAIEE 241 Query: 234 HGL-TSKDVPVTSIDGMPDAIQA 255 G+ +KD+ + SID + A +A Sbjct: 242 AGMKPAKDIVIISIDAVKGAFEA 264 Lambda K H 0.314 0.130 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 322 Length adjustment: 28 Effective length of query: 307 Effective length of database: 294 Effective search space: 90258 Effective search space used: 90258 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory