Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate Ac3H11_3036 Fructose ABC transporter, permease component FrcC
Query= uniprot:A0A1N7UKA9 (325 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3036 Length = 319 Score = 230 bits (586), Expect = 4e-65 Identities = 126/301 (41%), Positives = 186/301 (61%), Gaps = 8/301 (2%) Query: 29 LVFILLCVVMAFSSEYFMTWRNWMDILRQTSINGILAVGMTYVILTKGIDLSVGSILAFA 88 + IL C A SE F++ +N+ IL+Q + ++A+G T VILT GIDLS G ++A Sbjct: 18 IALILACAFFATQSERFLSAQNFALILQQVMVVAVIAIGQTLVILTAGIDLSCGMVMALG 77 Query: 89 GLCSAMVATQGYGLLA--AVSAGMFAGAMLGVVNGFMVANLSIPPFVATLGMLSIARGMT 146 G+ +A YGL A A++ GM + G++NG +V + +PPF+ TLG L+IA T Sbjct: 78 GIVMTKMAAD-YGLSAPVAIACGMAVTMLFGLINGLLVTKIKLPPFIVTLGTLNIAFAAT 136 Query: 147 FILNDGSPITDLPDAYLALG----IGKIGPIGVPIIIFAVVALIFWMVLRYTTYGRYVYA 202 + + ITD+P ALG +G+ + +++ A+ L+ W LR T GR+VYA Sbjct: 137 QLYSGAQTITDIPAGMTALGNTFQLGQTAIVWGAVLMLALY-LVTWFALRETAPGRHVYA 195 Query: 203 VGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSARTTSALPQAGVSYELDAIAAV 262 VG + ++ R +GI KV+ VYV++GL G+A ++ ART + P AG + LDAI+AV Sbjct: 196 VGNSPEATRLTGIATDKVLLGVYVLAGLFYGIASLLSVARTGAGDPNAGQTENLDAISAV 255 Query: 263 VIGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLGVSSYYQQVAKGLIIVFAVLIDVWRK 322 V+GGTSL GG G I+GTL GAL++GV NGL L+GVSS YQ + G++++ AV D + Sbjct: 256 VLGGTSLFGGRGVILGTLVGALIVGVFRNGLTLMGVSSVYQILVTGILVILAVATDQLSR 315 Query: 323 K 323 K Sbjct: 316 K 316 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 319 Length adjustment: 28 Effective length of query: 297 Effective length of database: 291 Effective search space: 86427 Effective search space used: 86427 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory