Align Probable 2-dehydro-3-deoxy-D-pentonate aldolase YjhH; EC 4.1.2.28 (characterized)
to candidate Ac3H11_277 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7)
Query= SwissProt::P39359 (301 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_277 Length = 299 Score = 129 bits (324), Expect = 8e-35 Identities = 94/298 (31%), Positives = 152/298 (51%), Gaps = 11/298 (3%) Query: 5 SGIIPPVSSTFHRDGTLDKKAMREVADFLINKGVDGLFYLGTGGEFSQMNTAQRMALAEE 64 +G I + + H DG++D A+R++ D+ I +G D + +GT GE +N + + Sbjct: 9 TGSIVALVTPMHADGSVDYPALRKLIDWHIAEGTDCIGVVGTTGESPTVNVEEHCEIIRV 68 Query: 65 AVTIVDGRVPVLIGVGSPSTDEAVKLAQHAQAYGADGIVAINPYYWKVAPRNLDDYYQQI 124 AV RVP++ G G+ ST EA++LA+ A+ GAD + + PYY K +++ I Sbjct: 69 AVEQSAKRVPIMAGCGANSTAEAIELAKFARGVGADSQLQVVPYYNKPTQEGQFQHFKAI 128 Query: 125 ARSV-TLPVILYNFPDLTGQDLTPETVTRLALQNENIVGIKDTIDSVGHLRTMINTVKSV 183 A + LP++LYN P + D+ +TV RLA Q I+GIK+ ++ + +I + V Sbjct: 129 AEATGDLPIVLYNVPGRSVADMQHDTVLRLA-QVPGIIGIKEATGNIERAQWLI---RDV 184 Query: 184 RPSFSVFCGYDDHLLNTMLLGGDGAITASANFAPELSVGIYRAWREGDLATAATLNKKLL 243 F V+ G D + ML GG G I+ +AN AP L + A GD A + KL+ Sbjct: 185 PQGFGVYSGDDPTAVALMLCGGHGNISVTANVAPRLMHELCVAALAGDARRAMEIQFKLM 244 Query: 244 QLPAIYALETPFVSLIKYSMQCVGLPVETYCLP--PILEASEEAKDKVHVLLTAQGIL 299 + +E + +K++M +GL T LP P+ +E V L + G+L Sbjct: 245 PVHKNLFVEANPIP-VKWAMARMGLCGGTMRLPMTPLASGNEAV---VEAALRSSGLL 298 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 299 Length adjustment: 27 Effective length of query: 274 Effective length of database: 272 Effective search space: 74528 Effective search space used: 74528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory