Align glycolaldehyde oxidoreductase medium subunit (characterized)
to candidate Ac3H11_3592 Carbon monoxide dehydrogenase medium chain (EC 1.2.99.2)
Query= metacyc::MONOMER-18072 (282 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3592 Length = 263 Score = 125 bits (315), Expect = 7e-34 Identities = 85/254 (33%), Positives = 134/254 (52%), Gaps = 17/254 (6%) Query: 30 LAGGQSLIPMLKLRVISPNYIVDLNPITSLSYVRSSFNSTKIGALTRYNEILKNDLVRVN 89 LAGGQSL+P ++LR+ +P IVDLN + L+ +R N+ IGA+TR+ ++ + V+ Sbjct: 26 LAGGQSLLPSMRLRLANPEKIVDLNGVAELAGIRRDGNALVIGAMTRHMDVASSADVKAA 85 Query: 90 VPLLHQAVRVVGDMQVRNLGTIGGSAANADPSADIPTVLTALNAEIILSSASGNRSVNAL 149 +P L +GD QVR GT+GGS AN DP+A P+ + L A +I + R + A Sbjct: 86 IPALADLAAHIGDRQVRARGTLGGSVANNDPAACYPSAVLGLGATVI----TNKREIAAD 141 Query: 150 DFFKGAFATDLRKGEIISEIVLPNLEGYRTIYKKVVRRAGDFALVSLALAIKLRQNEIED 209 DFF G + T L +GEII+ I P + R Y K + A F+LV + +A Sbjct: 142 DFFVGMYTTALEEGEIITAIRFPIPQ--RAAYMKFKQPASRFSLVGVFVA-----QTDSG 194 Query: 210 IRLAYGGVGERPFRALEVEKSVMGKRLNDELVEEIVSKVSSQVNP-PSDTRGSSWYRREV 268 +R+A G FR +E + L+ + V+ + SD S+ YR + Sbjct: 195 VRVAITGAATSVFRHAGLEAA-----LSQSFTAAAAAGVTIDASDLNSDIHASAAYRANL 249 Query: 269 MKVITRKALKEVSG 282 + V T++A++++ G Sbjct: 250 ISVQTQRAVQKMLG 263 Lambda K H 0.317 0.134 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 263 Length adjustment: 25 Effective length of query: 257 Effective length of database: 238 Effective search space: 61166 Effective search space used: 61166 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory