Align AraU, component of Arabinose, fructose, xylose porter (characterized)
to candidate Ac3H11_2065 Maltose/maltodextrin ABC transporter, permease protein MalG
Query= TCDB::Q97UF3 (295 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2065 Length = 289 Score = 139 bits (350), Expect = 8e-38 Identities = 86/285 (30%), Positives = 146/285 (51%), Gaps = 9/285 (3%) Query: 14 SIKYALLEIIAAILVIMWLVPLYAMILGGLKSNLEAASTPILLPPSKPSLDAYAFAWFGY 73 S+ L+ + A+ +L+PLYAM++ K E ST +L P + A+ AW Sbjct: 10 SVGRFLVYAVLALATAFFLLPLYAMLVTSFKYAEEIRSTSLLALPGSLNWSAWGTAWQSA 69 Query: 74 AT---IPGLEPTLLRYLLVAIPSVLLSVVIGTMTAYFFFVLSEKHGIISNGLFSIMALAT 130 T GL P + + +A+P+VL+S V G + Y VLS S+ LF ++ Sbjct: 70 CTGVDCNGLRPFFMNSVAMAVPAVLISTVWGALNGY---VLSLWKFRGSDALFGMLLFGV 126 Query: 131 FLPIETVTFPLIELETSLNVYNTYIGLIFAMLIFYVPTSALLMSIFLPVVPKYLIESARM 190 F+P + V P+ ++ L + ++ GL+ + + + L + +PK L+ +ARM Sbjct: 127 FMPFQVVLLPMSQVLGWLGLSSSITGLVLVHCLAGLAGTTLFFRNYYAAIPKELVNAARM 186 Query: 191 DGAGDWTILWRVVFPLIFPGFLSTLIFVFLQIWNEFFIPLILTNTPNM-LMLPVAARFYT 249 DGA + I WR+V PL P + TLI+ F IWN+F ++ + T + + + + T Sbjct: 187 DGASFFQIFWRIVLPLSTPIVMVTLIWQFTNIWNDFLFGVVFSGTDSKPVTVGLNNLANT 246 Query: 250 AAYALIYNRSFAAGVISSLIPLIIFIFLGRYFIRGLAALGGGAKG 294 ++ YN AA +I+ L ++I++ G++F+RGL A G KG Sbjct: 247 SSSVKAYNVDMAAAIIAGLPTMVIYVLAGKFFVRGLTA--GAVKG 289 Lambda K H 0.330 0.145 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 289 Length adjustment: 26 Effective length of query: 269 Effective length of database: 263 Effective search space: 70747 Effective search space used: 70747 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory