Align ABC transporter for D-Glucose-6-Phosphate, permease component 2 (characterized)
to candidate Ac3H11_2064 ABC-type sugar transport system, permease component
Query= reanno::WCS417:GFF4323 (302 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2064 Length = 293 Score = 407 bits (1045), Expect = e-118 Identities = 179/289 (61%), Positives = 238/289 (82%) Query: 14 DALQRWLPKLVLAPSMFIVLVGFYGYILWTFVLSFTNSTFLPTYKWAGLAQYARLFDNDR 73 + + WLPKLV+AP+ + YG ++W VLS T S LP Y+WAGLAQY RL++ DR Sbjct: 4 NTFETWLPKLVVAPAFVLGFAFIYGLMVWNGVLSLTVSRMLPNYEWAGLAQYERLWEMDR 63 Query: 74 WWVASKNLAVFGGMFIGITLVIGVTLAIFLDQKIRREGFIRTIYLYPMALSMIVTGTAWK 133 WWVA KNL +FG ++G +L+IGV LA+ LDQKIR EG +RTIYLYPMALS +VTGTAWK Sbjct: 64 WWVALKNLGIFGVGYVGGSLLIGVVLAVLLDQKIRAEGALRTIYLYPMALSFVVTGTAWK 123 Query: 134 WLLNPGMGLDKLLRDWGWEGFRLDWLIDPDRVVYCLVIAAVWQASGFIMAMFLAGLRGVD 193 WLLNPG+G++K++RDWG+ F WL+D + +YC+VIA +WQ++GF MA+FLAGLRG+D Sbjct: 124 WLLNPGLGIEKMVRDWGFPNFEFGWLVDTEMAIYCVVIAGIWQSAGFAMALFLAGLRGID 183 Query: 194 QSIVRAAQIDGASMPRIYWSVVLPSLRPVFFSAVMILAHIAIKSFDLVAAMTAGGPGYSS 253 SI++AAQ+DGAS+PRIYW +VLP+LRPVFFS +M+L+H+AIKSFDLV A+TAGGPG+++ Sbjct: 184 DSIIKAAQVDGASLPRIYWRIVLPALRPVFFSTLMVLSHLAIKSFDLVMALTAGGPGFAT 243 Query: 254 DLPAMFMYSFTFSRGQMGMGSASAILMLGAILAIIVPYLYSELRTKRND 302 D+PA FMY+ +FSRGQ+G+G+ASA +ML + A+++PYLYSELRTK +D Sbjct: 244 DVPATFMYTMSFSRGQIGLGAASATMMLATVAALVIPYLYSELRTKAHD 292 Lambda K H 0.330 0.141 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 293 Length adjustment: 26 Effective length of query: 276 Effective length of database: 267 Effective search space: 73692 Effective search space used: 73692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory