Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate Ac3H11_142 D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)
Query= curated2:A1RYE4 (339 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_142 Length = 313 Score = 162 bits (410), Expect = 1e-44 Identities = 99/265 (37%), Positives = 146/265 (55%), Gaps = 9/265 (3%) Query: 58 KIDAEVMDAAPNLKVISTYSVGFDHIDIPEATKRGIYVTHTPGVLTDAVAEFTVGLILAV 117 K+ A VMDAAP LKVIS + G D ID A RGI V G AVAE + L+LA Sbjct: 55 KVGAAVMDAAPALKVISKHGSGTDTIDKVAAKARGIEVVAAVGANAAAVAEQALTLLLAC 114 Query: 118 TRRIVEADKIIRTGQWDKPWNPYFLTGPELKGKTIGLVGLGRIGVATAKRLSSFDVKILY 177 + +V+ D + G WDK + EL G+T+GLVGLG IG+ AK + ++++ Sbjct: 115 AKSVVQLDARMHAGHWDKATHKSL----ELGGRTVGLVGLGAIGLRFAKMADALGMRVIG 170 Query: 178 YDIERRWDVETVIPNMEFTDLDTLLEKSDIVSIHVPLTKETYHLINEERLRKMKKTAYLI 237 +D + + ++ L+T+ ++D VS+H PLT E ++N L + K+ ++ Sbjct: 171 FDPFAK----NLPDYVQSVGLETIWREADAVSLHCPLTDENRGMLNATTLAQCKRGVIVV 226 Query: 238 NTARGPVVDTEALVKALKEGWIAGAALDVFEQEPLPPNHPLTKFDNVVLAPHIASATIEA 297 NTARG ++D AL+ A++ G + A LD F EP+ HP + +L+PHI T +A Sbjct: 227 NTARGGLIDEAALLAAVRSGQVMAAGLDSFAVEPMTTGHPFQGEKHFILSPHIGGVTSDA 286 Query: 298 RQRMAELAARNLIAVLKGEMPPALV 322 M AA+NL+AVL +P A V Sbjct: 287 YVNMGVGAAQNLLAVL-ARVPGAAV 310 Lambda K H 0.319 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 313 Length adjustment: 28 Effective length of query: 311 Effective length of database: 285 Effective search space: 88635 Effective search space used: 88635 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory