Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate Ac3H11_2395 D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)
Query= curated2:Q9YAW4 (335 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2395 Length = 335 Score = 160 bits (405), Expect = 4e-44 Identities = 109/296 (36%), Positives = 160/296 (54%), Gaps = 9/296 (3%) Query: 43 KAREADALYTLLTDR--IDCDLLSQAPRLRIVAQMAVGFDNIDVECATRLGIYVTNTPGV 100 + ++AD + L+ +R I L+ + PRL+++AQ +IDV T GI V G Sbjct: 43 RLKDADII-VLVRERTQITRQLVEKLPRLKLIAQTGKIGSHIDVAACTERGIAVAEGVGS 101 Query: 101 LTEATAEFTWALILAAARRVVEADHFVRWGEWWR--LRTGWHPMMM-LGVELRGKTLGIL 157 A AE TWAL++A+ RR+ + ++ G W + L+T P LG LRGKTLGI Sbjct: 102 PV-APAELTWALVMASMRRLPQYISNLKHGAWQQSGLKTASMPANFGLGNVLRGKTLGIW 160 Query: 158 GMGRIGSRVAEIGKAFGMRIIYHSRSRKREIEKELGAEYRSL-EDLLRESDILSIHLPLT 216 G GRIG VA G+AFGM + R R G + + E+ + D++S+HL L Sbjct: 161 GYGRIGQLVAGYGRAFGMNVRVWGREGSRAQALTDGYQAATTREEFFSQCDVISLHLRLN 220 Query: 217 DETRHLIGESELKLMKKTAILVNTGRGAIVDTGALVKALREGWIAAAALDVFEEEPLNPN 276 DETR LI +L MK T++LVNT R +++ AL+ AL G AA+DVFE EP+ Sbjct: 221 DETRGLISLEDLSCMKPTSLLVNTSRAELIEPDALIAALNRGRPGMAAVDVFESEPILQG 280 Query: 277 HPLTAFKNVVLAPHAASATRETRLRMAMMAAENLVAFAQGKVPPNLVNREVVKVRQ 332 H L +N + PH +++ A +N+V F +G P N+VN ++VR+ Sbjct: 281 HALLRLENCICTPHIGYVEQDSYELYFGAAFDNVVNFIKG-TPTNIVNPGSLQVRR 335 Lambda K H 0.322 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 335 Length adjustment: 28 Effective length of query: 307 Effective length of database: 307 Effective search space: 94249 Effective search space used: 94249 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory