Align NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) (characterized, see rationale)
to candidate Ac3H11_2762 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
Query= uniprot:A0A4R8NY47 (263 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2762 Length = 255 Score = 119 bits (299), Expect = 5e-32 Identities = 89/256 (34%), Positives = 131/256 (51%), Gaps = 20/256 (7%) Query: 17 LAGKRVVITGGGSGIGAALVEAFVGQGAQVCFLDIATEPSEALVASLKDAAVAPRFFPCN 76 LAG+R++ITGG SG+G LV + G GA V +D+ E EA+ AA A F + Sbjct: 6 LAGRRILITGGASGMGEGLVRSLTGMGALVVSMDLNRERGEAVAK----AAGARGFMEVD 61 Query: 77 LMNLEALRATFTEIETVMGGVDILINNAANDDRHKSEDVTPAYWDERLAVNLRHQFFCAQ 136 + + ++ T +GG+D+LI+ A ++ + A W++ AVN F + Sbjct: 62 VADEGSVARAVDAACTRLGGLDVLIHAAGIAPSSPAQGTSLALWEKVFAVNATGTFLMNR 121 Query: 137 AVLPGMRERKGGVILNFGSISWHLGLPDLTLYMTAKAGIEGMTHGMARDFGRDGVRVNAI 196 AV P MRE+ GG I+NF S + LGLP+ + Y AK + T +A+++G +RVNAI Sbjct: 122 AVFPHMREQ-GGSIINFASAAGALGLPNKSAYSAAKGAVLAWTRTVAQEWGPYNIRVNAI 180 Query: 197 IPGAIRTPR--QTLLWHTPEEEAKILAAQCLPVRVDP---------HDVAALALFLSSDS 245 P AI TP QT +PE+ + A L RV P D+ + FL+S Sbjct: 181 AP-AIWTPMYDQTRSEMSPEQ---LSAHDALMARVIPLGGKLGDMAQDLVPVLAFLASPG 236 Query: 246 GAKCTGREYYVDAGWL 261 TG+ + VD G L Sbjct: 237 ARFMTGQIFAVDGGTL 252 Lambda K H 0.322 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 255 Length adjustment: 24 Effective length of query: 239 Effective length of database: 231 Effective search space: 55209 Effective search space used: 55209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory