Align NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) (characterized, see rationale)
to candidate Ac3H11_614 Putative oxidoreductase in arabinose utilization cluster
Query= uniprot:A0A4R8NY47 (263 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_614 Length = 280 Score = 227 bits (578), Expect = 2e-64 Identities = 113/252 (44%), Positives = 160/252 (63%), Gaps = 2/252 (0%) Query: 12 ALYRSLAGKRVVITGGGSGIGAALVEAFVGQGAQVCFLDIATEPSEALVASLKDAAVA-P 70 A + SL G+ V +TGGGSGIGAA+V AF QGA+V F+D+A E SEAL + DA + P Sbjct: 29 AKFPSLQGRAVFVTGGGSGIGAAIVAAFAEQGARVAFVDVAREASEALAQHIADAGLPRP 88 Query: 71 RFFPCNLMNLEALRATFTEIETVMGG-VDILINNAANDDRHKSEDVTPAYWDERLAVNLR 129 + C++ +++AL+A + +G +L+NN A+DDRH E VTP Y+DER+A+N R Sbjct: 89 WWRVCDVRDVQALQACMADAAAELGSDFAVLVNNVASDDRHTLESVTPEYYDERMAINER 148 Query: 130 HQFFCAQAVLPGMRERKGGVILNFGSISWHLGLPDLTLYMTAKAGIEGMTHGMARDFGRD 189 FF QAV+PGMR G ++N GS W Y AK+ + G+T G+A+ G+D Sbjct: 149 PAFFAIQAVVPGMRRLGAGSVINLGSTGWQGKGTGYPCYAIAKSSVNGLTRGLAKTLGQD 208 Query: 190 GVRVNAIIPGAIRTPRQTLLWHTPEEEAKILAAQCLPVRVDPHDVAALALFLSSDSGAKC 249 +R+N + PG + T RQ LW E E ++ QCLP ++ PHD+A + LFL+SD A C Sbjct: 209 RIRINTVSPGWVMTERQIKLWLDAEGEKELARNQCLPDKLRPHDIARMVLFLASDDAAMC 268 Query: 250 TGREYYVDAGWL 261 T +E+ VDAGW+ Sbjct: 269 TAQEFKVDAGWV 280 Lambda K H 0.322 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 280 Length adjustment: 25 Effective length of query: 238 Effective length of database: 255 Effective search space: 60690 Effective search space used: 60690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory