Align Xylonolactonase (EC 3.1.1.68) (characterized)
to candidate Ac3H11_2081 Gluconolactonase (EC 3.1.1.17)
Query= reanno::Korea:Ga0059261_1893 (295 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2081 Length = 316 Score = 160 bits (406), Expect = 3e-44 Identities = 110/303 (36%), Positives = 146/303 (48%), Gaps = 25/303 (8%) Query: 6 TAPEPVWALGAPLLEGPVWVQRDAALWFVDIKSHRIHRFDPASGERRSWDAPAQVGFCLP 65 T P P LG E P W + +L++ DI+ +H + P SG R W P++ G C P Sbjct: 5 TLPLPPSELG----ESPFWHPTEKSLYWCDIQGQAVHAWHPESGRHRQWRMPSEPGCCAP 60 Query: 66 AANGKFVAGLQTGLAIFDPADRSFTP-------LTDPEPALPGN-RLNDGTVDPAGRLWF 117 AA+G+ V GL+ G + D A S P L PE RLNDG D AGR W Sbjct: 61 AADGQLVIGLRNGFYLLDTAKGSTDPTALTCLALLPPEQHDTAVLRLNDGRCDTAGRFWA 120 Query: 118 GTMDDGESEATGRIYRLGGD-----GRCVAETAAVSIS-NGPAVSPDGRTLYHVDTLGGV 171 G++ + ++ L D G V A + + NG A SPD RTLY +T Sbjct: 121 GSVITPRTAPNAALWCLQADAASATGYRVRHMAGDNFTANGLAFSPDDRTLYWSNTPEHR 180 Query: 172 IHSAAIG-DDGILGDSRVFATIPNSE------GFPDGPAVDAEGCVWIGLYNGAAVRRYS 224 I D G + + R + G PDG AVD EG W+ +Y GA V + S Sbjct: 181 IDQFDFDVDTGAISNRRPWVQFDRKVEGQPYGGRPDGAAVDVEGNYWVAMYEGACVLQLS 240 Query: 225 PAGELLDVVAFPVGAITKVAFGGPDLRTVYATTASKHLDADGRAEEPHAGDLFAFRVSVP 284 PAGE+L + PV T V FGG DLRT++ T+A + R E AG LF+ RV+V Sbjct: 241 PAGEVLQRIEVPVQCPTMVCFGGEDLRTLFITSARAGRPVEEREAEVPAGSLFSVRVTVA 300 Query: 285 GMP 287 G+P Sbjct: 301 GLP 303 Lambda K H 0.319 0.139 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 316 Length adjustment: 27 Effective length of query: 268 Effective length of database: 289 Effective search space: 77452 Effective search space used: 77452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory