Align Ribose import ATP-binding protein RbsA 1; EC 7.5.2.7 (characterized, see rationale)
to candidate Ac3H11_2881 Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)
Query= uniprot:Q9WXX0 (520 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2881 Length = 496 Score = 358 bits (919), Expect = e-103 Identities = 201/500 (40%), Positives = 307/500 (61%), Gaps = 15/500 (3%) Query: 18 KGIVKRFPGVVAVDNVDFEVYENEIVSLIGENGAGKSTLIKILTGVLKPDAGEILVNGE- 76 + + K F V + V F + + L+GENGAGKSTL+KIL G P GE++V+G Sbjct: 8 RNVTKEFGPVRVLHGVGFALQPGRVYGLLGENGAGKSTLMKILAGYESPTTGEVVVDGAV 67 Query: 77 RVEFHSPVDAFKKGISVIHQELNLCDNMTVAENIFLAYEAVRGQKRTLSSRVDENYMYTR 136 R A +GI +IHQE NL D++T+A+NIFL +E RG +D+ M + Sbjct: 68 RAPGGGSRAAEAQGIVLIHQEFNLADDLTIAQNIFLGHEIKRGLF------LDDKAMREK 121 Query: 137 SKELLDLIGAKFSPDALVRNLTTAQRQMVEICKALVKEPRIIFMDEPTSSLTVEETERLF 196 ++E L +G PD VR L A++Q+VEI +AL + R++ MDEPT++LT ETERLF Sbjct: 122 TREALAKVGLPLDPDTRVRKLIVAEKQLVEIARALARNARLLIMDEPTATLTPGETERLF 181 Query: 197 EIIEMLKSRGISVVFVSHRLDEVMRISDRIVVMRDGKRIGELKKGEFDVDTIIKMMVGRE 256 ++ LK+ G++++++SH+LDEV R +D +VVMRDG + + +MVGRE Sbjct: 182 ALMAGLKAAGVTIIYISHKLDEVERTTDEVVVMRDGLLVAREATASVTRRQMANLMVGRE 241 Query: 257 V-EFFPHGIET-RPGEIALEVRNLKWKDKVKNVSFEVRKGEVLGFAGLVGAGRTETMLLV 314 + + FP + + G A+ VR L + V FEVR+GE+LGFAGLVGAGRTE + Sbjct: 242 LADLFPPKLPAPQDGAPAITVRGLTVPGWAEGVDFEVRRGEILGFAGLVGAGRTELFEGL 301 Query: 315 FGVNQKESGDIYVNGRKVEIKNPEDAIKMGIGLIPEDRKLQGLVLRMTVKDNIVLPSLKK 374 G+ + +G + + G+ V++K+P DA + G+ + EDRK +GL + ++ N+ L +L++ Sbjct: 302 LGLRPRTAGTVEIAGQPVQLKSPRDAARHGLTYLSEDRKGKGLHVHFGLRPNLTLMALER 361 Query: 375 ISR-WGLVLDERKEEEISEDYVKRLSIKTPSIYQITENLSGGNQQKVVLAKWLATNADIL 433 ++ W LD E+ + V+ I+T S+ +LSGGNQQK+ LAK L ++ Sbjct: 362 YAKPW---LDPAAEQAALREAVQEFGIRTGSLEVRASSLSGGNQQKLALAKVLHPGPSVV 418 Query: 434 IFDEPTRGIDVGAKAEIHRMIRELAAQGKAVIMISSELPEILNLSDRIVVMWEGEITAVL 493 + DEPTRG+DVGAK EI+ +++ LA QG AVI+ISSEL E++ L R+ VM G + L Sbjct: 419 VLDEPTRGVDVGAKREIYHLVQRLAEQGLAVIVISSELMELIGLCHRVAVMRAGRLQTTL 478 Query: 494 DNREKRVTQEEIMYYASGQK 513 +E +T+EE++ +A+G + Sbjct: 479 --QEPHLTEEELIAHATGTR 496 Lambda K H 0.319 0.138 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 614 Number of extensions: 34 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 520 Length of database: 496 Length adjustment: 34 Effective length of query: 486 Effective length of database: 462 Effective search space: 224532 Effective search space used: 224532 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory