Align D-xylose reductase (EC 1.1.1.307) (characterized)
to candidate Ac3H11_4133 Aldo-keto reductase
Query= BRENDA::F2YCN5 (340 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4133 Length = 346 Score = 133 bits (335), Expect = 6e-36 Identities = 86/252 (34%), Positives = 134/252 (53%), Gaps = 8/252 (3%) Query: 38 WGGTDDDASIKTIHRAIDLGINIIDTAPAYGRGHAEEVVGKAIK----GQRDNLIIATKV 93 +G TDD S+ T+H A LG+N DTA AYG GH E ++G+ + GQR + +ATK Sbjct: 37 YGQTDDAQSLATLHMAHGLGVNHFDTADAYGFGHNESLLGRFLHELSPGQRAEVTVATKF 96 Query: 94 GLDWTLTPDQSMRR-NSSASRIKKEIEDSLRRLGTDYIDLYQVHWPDPLVPIEETATILE 152 G+ P + RR ++S + I++ + SL+RLG + IDLY H DP VP+E+ L Sbjct: 97 GI--VREPGRYERRIDNSPAYIRQACDASLQRLGVERIDLYYCHRRDPAVPLEDLMGTLA 154 Query: 153 ALRKEGKIRSIGVSNYSVQQMDEFKKYAELAVSQSPYNLFEREIDKDILPYAKKNDLVVL 212 L + GKI ++G+S S + + +A QS Y+L+ER ++ +LP A+ + + Sbjct: 155 DLVRAGKIAAVGLSEVSAESLRTAHALHPVAAVQSEYSLWERGAEQAVLPTAQALGIAFV 214 Query: 213 GYGALCRGLLSGRMTADRAFTGDDLRKTDPKFQKPRFEHYLAAVEELKKLAKEHYNKSVL 272 Y L R L+ + A DD R+ P+F + + + L +LA + V Sbjct: 215 AYSPLGRAFLTDQPPVLDALAPDDFRRALPRFNGAEGQANRSLQQGLAQLA-QSAGLPVT 273 Query: 273 ALAIRWMLEQGP 284 LA+ WML + P Sbjct: 274 TLALAWMLNRHP 285 Lambda K H 0.317 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 346 Length adjustment: 29 Effective length of query: 311 Effective length of database: 317 Effective search space: 98587 Effective search space used: 98587 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory