GapMind for catabolism of small carbon sources

 

Protein AZOBR_RS00675 in Azospirillum brasilense Sp245

Annotation: FitnessBrowser__azobra:AZOBR_RS00675

Length: 229 amino acids

Source: azobra in FitnessBrowser

Candidate for 12 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-lysine catabolism hisM med ABC transporter for L-Lysine, permease component 2 (characterized) 53% 96% 227.3 OCM1 aka OccM, component of Octopine porter 56% 254.2
L-histidine catabolism BPHYT_RS24010 med Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale) 47% 91% 222.6 OCM1 aka OccM, component of Octopine porter 56% 254.2
L-arginine catabolism artM med ABC transporter for L-Arginine, permease component 2 (characterized) 47% 98% 216.5 OCM1 aka OccM, component of Octopine porter 56% 254.2
L-citrulline catabolism AO353_03045 med ABC transporter for L-Arginine and L-Citrulline, permease component 2 (characterized) 47% 98% 216.1 OCM1 aka OccM, component of Octopine porter 56% 254.2
L-histidine catabolism hisM med Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 47% 95% 213 OCM1 aka OccM, component of Octopine porter 56% 254.2
L-histidine catabolism Ac3H11_2554 lo ABC transporter for L-Histidine, permease component 1 (characterized) 37% 98% 152.9 OCM1 aka OccM, component of Octopine porter 56% 254.2
L-citrulline catabolism PS417_17600 lo ABC transporter permease; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine ABC transporter permease HisM; SubName: Full=Histidine transport system permease protein; SubName: Full=Histidine/lysine/arginine/ornithine ABC transporter permease HisM (characterized, see rationale) 39% 90% 147.5 OCM1 aka OccM, component of Octopine porter 56% 254.2
L-histidine catabolism BPHYT_RS24005 lo Polar amino acid ABC transporter, inner membrane subunit; Flags: Precursor (characterized, see rationale) 35% 89% 109.8 OCM1 aka OccM, component of Octopine porter 56% 254.2
L-citrulline catabolism PS417_17595 lo ABC transporter permease subunit; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine transport system permease protein (characterized, see rationale) 33% 91% 105.9 OCM1 aka OccM, component of Octopine porter 56% 254.2
L-asparagine catabolism aatQ lo Glutamate/aspartate import permease protein GltJ (characterized) 32% 90% 89.7 OCM1 aka OccM, component of Octopine porter 56% 254.2
L-aspartate catabolism aatQ lo Glutamate/aspartate import permease protein GltJ (characterized) 32% 90% 89.7 OCM1 aka OccM, component of Octopine porter 56% 254.2
L-glutamate catabolism gltJ lo Glutamate/aspartate import permease protein GltJ (characterized) 32% 90% 89.7 OCM1 aka OccM, component of Octopine porter 56% 254.2

Sequence Analysis Tools

View AZOBR_RS00675 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MNWDLMWDSVPTLLRGVPVTLQLVGLALLFGAGVAFAVALLRLYGNRVTERLMAAYVFVF
RGTPLLVQIFLIYYGMGQFELVRSSFLWVYLREPFWCAILALTLNTGAYTSEILRGAILS
VPQGQIEAARACGMSRTLLFRRIMMPVAIRQMLPAYGNEVILMVKASSLASTITLLEITG
IARKIIAQSFAVFEVFIVAGSIYLLLNFIASRLIRYAEWRMTPYLRARG

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory