GapMind for catabolism of small carbon sources

 

Protein AZOBR_RS29185 in Azospirillum brasilense Sp245

Annotation: AZOBR_RS29185 aldehyde dehydrogenase

Length: 478 amino acids

Source: azobra in FitnessBrowser

Candidate for 21 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arabinose catabolism xacF hi 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) (characterized) 55% 98% 503.4
D-galacturonate catabolism dopDH hi 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) (characterized) 55% 98% 503.4
D-glucuronate catabolism dopDH hi 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) (characterized) 55% 98% 503.4
D-xylose catabolism dopDH hi 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) (characterized) 55% 98% 503.4
L-fucose catabolism aldA med lactaldehyde dehydrogenase (EC 1.2.1.22); 2,5-dioxovalerate dehydrogenase (EC 1.2.1.26) (characterized) 42% 99% 354 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4
L-rhamnose catabolism aldA med lactaldehyde dehydrogenase (EC 1.2.1.22); 2,5-dioxovalerate dehydrogenase (EC 1.2.1.26) (characterized) 42% 99% 354 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4
L-threonine catabolism aldA med lactaldehyde dehydrogenase (EC 1.2.1.22); 2,5-dioxovalerate dehydrogenase (EC 1.2.1.26) (characterized) 42% 99% 354 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4
L-arginine catabolism putA lo L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized) 34% 89% 259.2 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4
L-arginine catabolism rocA lo L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized) 34% 89% 259.2 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4
L-citrulline catabolism putA lo L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized) 34% 89% 259.2 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4
L-citrulline catabolism rocA lo L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized) 34% 89% 259.2 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4
L-proline catabolism putA lo L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized) 34% 89% 259.2 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4
L-valine catabolism mmsA lo Malonate-semialdehyde dehydrogenase 1; MSA dehydrogenase 1; EC 1.2.1.-; Methylmalonate-semialdehyde dehydrogenase 1; MMSA dehydrogenase 1; MSDH 1; EC 1.2.1.27 (uncharacterized) 35% 97% 258.5 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4
L-isoleucine catabolism iolA lo malonate-semialdehyde dehydrogenase (acetylating) (EC 1.2.1.18) (characterized) 36% 95% 256.9 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4
myo-inositol catabolism mmsA lo malonate-semialdehyde dehydrogenase (acetylating) (EC 1.2.1.18) (characterized) 36% 95% 256.9 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4
propionate catabolism iolA lo malonate-semialdehyde dehydrogenase (acetylating) (EC 1.2.1.18) (characterized) 36% 95% 256.9 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4
L-threonine catabolism iolA lo malonate-semialdehyde dehydrogenase (acetylating) (EC 1.2.1.18) (characterized) 36% 95% 256.9 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4
L-valine catabolism iolA lo malonate-semialdehyde dehydrogenase (acetylating) (EC 1.2.1.18) (characterized) 36% 95% 256.9 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4
L-lysine catabolism amaB lo aldehyde dehydrogenase (NAD+) (EC 1.2.1.3); L-aminoadipate-semialdehyde dehydrogenase (EC 1.2.1.31) (characterized) 35% 85% 244.2 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4
L-arginine catabolism astD lo N-succinylglutamate 5-semialdehyde dehydrogenase; EC 1.2.1.71; Succinylglutamic semialdehyde dehydrogenase; SGSD (uncharacterized) 37% 91% 217.2 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4
L-citrulline catabolism astD lo N-succinylglutamate 5-semialdehyde dehydrogenase; EC 1.2.1.71; Succinylglutamic semialdehyde dehydrogenase; SGSD (uncharacterized) 37% 91% 217.2 2-ketoglutaric semialdehyde dehydrogenase (EC 1.2.1.26) 55% 503.4

Sequence Analysis Tools

View AZOBR_RS29185 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices: TMHMM

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MMERRNWIAGRLVDGVRMEANRNPARPGEVIGHYAWASVEQAEEALGAAHAALPGWAASN
PQTRSDVLRRVGDELNARAEELGALLTREEGKTLREGIGEVRRSAQIFHYAAGEPLRQGG
EALPGLRDGTTAMVSREPVGVVVLITPWNFPMAVPAWKTAYALAFGNTVVLKPSEVTPAC
AWELADILHRAGLPAGAFNLVVGDGRTLGPALVDGADAVSFTGSPGVGRAILERSVARMT
RVQLELGGKNPLVVHDDADLELAVDIALQGAFHSTGQRCTATSRIIVDRRVHDAFVERLV
TRIAALRVGDPMDAATDMGPVVSEAQLAKDLHCIADARSEGAELAFGGGRMDGDGYFLEP
TLFVGTDNAMRINRDEVFGPVACVIPADGLDHAIAIANDSDHALSSGIVTRGLASAETFR
RRSRAGLVMVNAPTAGIDYHVPFGGRGPSGYGGREQGSAAVEFFTEGKTAYINHGIAG

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory