Align alpha-ketoglutarate TRAP transporter, solute receptor component (characterized)
to candidate AZOBR_RS16505 AZOBR_RS16505 hypothetical protein
Query= reanno::psRCH2:GFF85 (317 letters) >FitnessBrowser__azobra:AZOBR_RS16505 Length = 328 Score = 173 bits (439), Expect = 4e-48 Identities = 112/327 (34%), Positives = 174/327 (53%), Gaps = 12/327 (3%) Query: 1 MRLTKRLGL--LAAAAAFTASTAAVAAPTFINILTGGTSGVYYPIGVALSQQYNKIDGAK 58 M T+RL +A A A A+ A P F I TGGT+G YYP+G ++ + +G Sbjct: 4 MSKTRRLAFAAVAGAVAIGATVAVAQTPAFFRIGTGGTAGTYYPVGGLIANVISGANGGV 63 Query: 59 TSVQAT----KASVENLNLLQAGRGELAFSLGDSVEDAWNGVEDAGFKAPLKRLRAIAGT 114 ++ AT SV N+N ++ G E FS D A G K ++ LR IA Sbjct: 64 PALVATAVASNGSVANINAIKGGSSESGFSQSDVAYWAHTGTGLFEGKGKVEDLRVIATL 123 Query: 115 YNNYIQIVASAESGIKTLDDLKGKRISVGAPKSGTELNARAIFKAAGLDYKDMGRVEFLP 174 Y I +VA ++ IK++ DLKGKR+S+ P SGT +++R + A GL KD+ + E+L Sbjct: 124 YPETIHLVARKDANIKSVADLKGKRVSLDEPGSGTLVDSRIVLGAFGLTEKDV-KAEYLK 182 Query: 175 YAESVELIKNRQLDATLQSSGLGMAAIRDLASTMPVTFVEIPAEVVEKI--ESDAYLAGV 232 + + +++ LDA G AI +LA++ ++ V I ++K+ + + Sbjct: 183 PGPAGDRLRDGALDAYFFVGGYPTGAISELATSSGISLVPITGPEIDKMLAQYQFFAKDT 242 Query: 233 IPAGTYDGQDADVPTVAITNILVTHEKVSDEVAYQMTKLMFD--NLAALGNAHSAAKDIK 290 +PA TY + PT+++ +T K D++ Y + K +++ + AAL H+ K + Sbjct: 243 VPANTYK-DVPETPTISVNAQWLTSAKQPDDLVYNIVKTLYNEKSRAALEAGHAKGKLVT 301 Query: 291 LENATKNLPIPLHPGAERFYKEAGVLK 317 L+ AT L IPLHPGAE+FYKE GVLK Sbjct: 302 LQTATNGLGIPLHPGAEKFYKEQGVLK 328 Lambda K H 0.314 0.131 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 328 Length adjustment: 28 Effective length of query: 289 Effective length of database: 300 Effective search space: 86700 Effective search space used: 86700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory