Align dicarboxylate TRAP transporter (succinate, fumarate, L-malate, and alpha-ketoglutarate), large permease component (characterized)
to candidate AZOBR_RS31520 AZOBR_RS31520 membrane protein
Query= reanno::PV4:5208943 (465 letters) >FitnessBrowser__azobra:AZOBR_RS31520 Length = 423 Score = 224 bits (570), Expect = 6e-63 Identities = 145/459 (31%), Positives = 239/459 (52%), Gaps = 42/459 (9%) Query: 1 MTIATLFISLFLCMLLGMPIAIALGFSSMLTILLFSDDSLASVALKLYESTSEHYTLLAI 60 MT +SL L + G+ IA+ALG ++ + + + VA ++S + Y L+ I Sbjct: 1 MTSIIAVVSLLLLVAGGVHIALALGVIAVGLLTFNFNIPVVLVAQMAWDSVDK-YALVCI 59 Query: 61 PFFILSSAFLSTGGVARRIIDFAMDSVGHIRGGLAMASVMACMLFAAVSGSSPATVAAIG 120 PFFI + +S G +A I+D + RGG+A+A M+ + FAAV+GSS A A+G Sbjct: 60 PFFIFAGNLMSRGNLALVILDLVGTVIRWFRGGVALALAMSSVFFAAVNGSSVACAVALG 119 Query: 121 SIVIVGMVRAGYPEKFAAGVITTSGTLGILIPPSIVMLVYAAATEVSAARMFMAGLIPGL 180 + + GYP +FAA ++ GTLG++IPPS+ ++ + + +F+AG++PGL Sbjct: 120 PAAVKLLPAEGYPPRFAASLVAVCGTLGLMIPPSLTFILIGSIVGLPITDLFIAGIVPGL 179 Query: 181 MMGLLLMLAIYIVARIK---KLPSRP-FPGFRPLAISSAKAMGGLALIVIVLGSIYGGIA 236 LL L IV+RI ++ RP + GF +A G L + VI++G+IY G Sbjct: 180 FEAFLLGLTTLIVSRINGYGRVGERPDWKGFGQRLPGAA---GALMMPVIIIGTIYMGWF 236 Query: 237 SPTEAAAVACVYAYFIAVFGYRDIGPLKNVSWRDSGEPLIRAILRNLGFMVLAVFKTPAD 296 +PTE +A+A VYA + YR + AV++T Sbjct: 237 TPTEVSALAAVYAVVLVTMVYRTAN-------------------------LAAVWET--- 268 Query: 297 KEIRHVVRDGAKVSIMLLFIIANAMLFAHVLTTERIPHLIAETIVGMGLPVWGFLIIVNL 356 R+ ++M+ ++ + L VLT + + + + + FL+ VNL Sbjct: 269 ------ARESVLQTVMIYGVLLGSGLLTAVLTRLGLSAELTAMLKEAQVSPFEFLLAVNL 322 Query: 357 LLLAAGNFMEPSAILLIMAPILFPIATQLGIDPIHLGIIMVVNMEIGMLTPPVGLNLFVT 416 LLL G F++ ++++++APILFP+A +G++PIH +IM +E+ LTPPVGLNLFV Sbjct: 323 LLLVVGMFLDGVSMIVLLAPILFPMAQAVGVNPIHFAVIMTALVEVATLTPPVGLNLFVM 382 Query: 417 AGITGRSMGWVIHSCIPWLALLLFFLALITYIPQISLFL 455 + IT + ++ +P+ + + L +I P +SL L Sbjct: 383 SRITKMPLHAIVKGVLPFYGMRVVALLVINAFPALSLVL 421 Lambda K H 0.330 0.144 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 521 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 465 Length of database: 423 Length adjustment: 32 Effective length of query: 433 Effective length of database: 391 Effective search space: 169303 Effective search space used: 169303 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory