Align C4-dicarboxylate-binding periplasmic protein DctP (characterized)
to candidate AZOBR_RS09605 AZOBR_RS09605 C4-dicarboxylate ABC transporter
Query= SwissProt::A3QCW5 (336 letters) >FitnessBrowser__azobra:AZOBR_RS09605 Length = 336 Score = 248 bits (633), Expect = 2e-70 Identities = 134/321 (41%), Positives = 193/321 (60%), Gaps = 1/321 (0%) Query: 9 FIKQIVKMTSIAALLGASLNSWAAPTEIKFSHVVAENTPKGQMALKFKQLVEERLPGEYQ 68 F+ + + L+ A+ + P IKFSHVVA TPKG+ A KFKQL E+R G+ + Sbjct: 3 FVSLLCATVAAGCLMAATAATAQEPIVIKFSHVVAPETPKGKGAEKFKQLAEQRTAGKVK 62 Query: 69 VNVFPNSQLFGDNNELSALLLNDVQFVAPSLSKFERY-TKKLQLFDLPFLFKDMDAVNRF 127 V V+PNSQL+ D EL AL L VQ +APSL+KF K+ ++FDLP++F A+ + Sbjct: 63 VEVYPNSQLYKDKEELEALQLGAVQMLAPSLAKFGPLGAKEFEIFDLPYIFPCKTALVKV 122 Query: 128 QQSDAGQQLLNSMKRKGVVGLGYLHNGMKQFSASSPLVLPEDAQGKKFRIMASDVLAAQF 187 G+QL ++ KG+ GL Y NG K SA+ PL D +G K RI +S VL AQ Sbjct: 123 TTGPIGKQLFQKLENKGITGLAYWDNGFKIMSANKPLHATADFKGLKMRIQSSKVLDAQM 182 Query: 188 QAVEAIPVKKPFSEVFTLLQTRAIDGQENTWSNIYSKKFYEVQSNITESNHGVLDYMVVT 247 +A+ A+P FSEV+ LQT +DG EN SN+Y++K +EVQS+ T S+HG L Y V+ Sbjct: 183 RALGALPQVMAFSEVYQALQTGVVDGTENPPSNMYTQKMHEVQSHATLSDHGYLGYAVIV 242 Query: 248 SNTFWKSLPADKRKVIKASLDEAIAYGNEIAAAKVNKDKQAIIDSKRSEVTYLTPEQRAA 307 + FW LPAD R + ++ EA Y N IA + +K +A+ + +++ LT ++RA+ Sbjct: 243 NKKFWDGLPADVRTQLDGAMKEATEYANNIAQEENDKALEAMKAAGKTKFYELTKDERAS 302 Query: 308 WVNAMKPVWAQFEDKIGKDLI 328 W AM PV ++GK+L+ Sbjct: 303 WRQAMLPVHEDMASRVGKELL 323 Lambda K H 0.317 0.130 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 336 Length adjustment: 28 Effective length of query: 308 Effective length of database: 308 Effective search space: 94864 Effective search space used: 94864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory