Align 4-oxalmesaconate hydratase; OMA hydratase; Gallate degradation protein B; EC 4.2.1.83 (characterized)
to candidate AZOBR_RS26910 AZOBR_RS26910 GlcNAc-PI de-N-acetylase
Query= SwissProt::Q88JX8 (258 letters) >FitnessBrowser__azobra:AZOBR_RS26910 Length = 244 Score = 297 bits (760), Expect = 2e-85 Identities = 144/240 (60%), Positives = 177/240 (73%), Gaps = 2/240 (0%) Query: 20 KSALVVSAHSADFVWRAGGAIALHAEQGYAMHVVCLSFGERGESAKLWRKGEMTEAKVKD 79 K ALV+SAHSADFVWRAGGAIALH ++GY + +VCLS+GERGESAKLW++ T VK Sbjct: 5 KRALVLSAHSADFVWRAGGAIALHQKKGYEVTIVCLSYGERGESAKLWKQDGCTLDHVKT 64 Query: 80 ARREEAMAAAEILGA-SVEFFDIGDYPMRADKDTLFRLADVYRRVQPEFVLSHSLKDPYN 138 RR+EA AAA+ L A ++FFD+GDYP+ D++ FRL DV R+VQP F++SHS DPYN Sbjct: 65 ERRKEAEAAAKALNAHDIQFFDLGDYPLEIDREAKFRLVDVIRKVQPAFLMSHSHYDPYN 124 Query: 139 YDHPLAMHLAQEARIIAQAEGYKPGEKIVGAPPVYAFEPHQPEQCEWRPDTFLDITSVWD 198 DH A + E R+IAQA G+ PG+K++GAP +Y FEPHQ EQ W+PD FLDIT VWD Sbjct: 125 TDHSYATKVLMECRMIAQAWGHNPGQKVLGAPQLYLFEPHQTEQMGWKPDVFLDITEVWD 184 Query: 199 KKYAAIQCMAGQEHLWEYYTRVALQRGVQAKRNV-GITSARNIVYAEGLQSVFPRVTENL 257 K AAI+CMAGQEHLW+YYT +A RG +RN G RN YAEG QSV+PR + L Sbjct: 185 NKRAAIECMAGQEHLWDYYTNLAQNRGNHFRRNSGGQAGGRNARYAEGFQSVYPRTVDEL 244 Lambda K H 0.320 0.132 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 244 Length adjustment: 24 Effective length of query: 234 Effective length of database: 220 Effective search space: 51480 Effective search space used: 51480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory