Align 4-oxalomesaconate tautomerase; Gallate degradation protein D; EC 5.3.2.8 (characterized)
to candidate AZOBR_RS24310 AZOBR_RS24310 3-methylitaconate isomerase
Query= SwissProt::Q88JY0 (361 letters) >FitnessBrowser__azobra:AZOBR_RS24310 Length = 401 Score = 202 bits (514), Expect = 1e-56 Identities = 143/401 (35%), Positives = 206/401 (51%), Gaps = 52/401 (12%) Query: 3 QTRIPCLLMRGGTSKGAYFLHDDLP----APGPLRDRVLLAVMGSPD--ARQIDGIGGAD 56 Q RIP MRGGTSKG +F DDLP PG RDR+ L V+GSPD A+ IDG+GGA Sbjct: 6 QIRIPATYMRGGTSKGVFFRLDDLPERCRVPGEARDRLFLRVIGSPDPYAKHIDGMGGAS 65 Query: 57 SLTSKVAIIRASQRDDADVDYLFAQVVVDEARVDYGQNCGNILAGVGPFALERGL----- 111 S TSK I+ S R DVDYL+ QV +D A VD+ NCGN+ G FA+ GL Sbjct: 66 SSTSKCVILSKSARPGHDVDYLYGQVAIDAAFVDWSGNCGNLSTAAGAFAIHAGLVDPAR 125 Query: 112 VAASGASTPVRIFMENTGQIAVAQVPTADGQVEYAGDTRIDGVPGRAAALVVTFADVA-- 169 V +G T VRI+ N G+ +A VP GQV+ G +DGV AA +V+ F D A Sbjct: 126 VPENGVCT-VRIWQANIGKTIIAHVPVTAGQVQETGSFALDGVTFPAAEIVLEFIDPADE 184 Query: 170 --GASCGALLPTGNSRDCVE---------GVEVTCIDNGMPVVLLCAEDLGVTGYEPCET 218 G++LPTGN D ++ ++ T I+ G+P + + A DLG G E Sbjct: 185 GESEGGGSMLPTGNPIDDLDVPDSLVPGGRLKATLINAGIPTIFIDAADLGYRGTESQAA 244 Query: 219 LEADSALKTRLEAIR----LQLGPRMNLGDVSQR-NVPKMCLLSAP-----RNGGTVN-- 266 + D+ R EA+R L++G G+ ++R + PK+ ++ P +G V Sbjct: 245 INGDATALARFEALRTIGALRMGLIREPGEAARRQHTPKIAFVAPPDAYTASSGKRVEAG 304 Query: 267 -----TRSFIPHRCHASIGVFGAVSVATACLIEGSVAQGLASTSGGDRQRLAVEHPSGEF 321 R+ + H ++ +V++A A + G++ A GG R + HPSG Sbjct: 305 DIDLLVRALSMGKLHHAMMGTASVAIAAAAAVPGTLVNRAA--GGGTRNAVRFGHPSG-- 360 Query: 322 TVEISLEHGVIKGCGLV------RTARLLFDGVVCIGRDTW 356 T+ + E ++ G V R+AR+L +G VC+ D++ Sbjct: 361 TLRVGAEAALVDGRWTVTKAIMSRSARVLMEGWVCVPADSF 401 Lambda K H 0.320 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 428 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 401 Length adjustment: 30 Effective length of query: 331 Effective length of database: 371 Effective search space: 122801 Effective search space used: 122801 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory