Align 2-keto-4-pentenoate hydratase 2; EC 4.2.1.80; 2-hydroxypentadienoic acid hydratase 2 (uncharacterized)
to candidate AZOBR_RS15705 AZOBR_RS15705 2-keto-4-pentenoate hydratase
Query= curated2:Q49KF9 (270 letters) >FitnessBrowser__azobra:AZOBR_RS15705 Length = 254 Score = 67.8 bits (164), Expect = 2e-16 Identities = 60/204 (29%), Positives = 93/204 (45%), Gaps = 13/204 (6%) Query: 48 QAYAIANGRRLVGRKIGLTNPKVQAQLGVDQPDF----GCLFADMAYGDNEVIPFERVLQ 103 +AYAI + V R++G P V ++G PD + AD + D +P Sbjct: 39 EAYAIQDA---VARRLG---PVVAWKVGARTPDTEPFRAPIHADTLFFDTTTLPAADYQV 92 Query: 104 PKIEAEIALILERDLPSASTTFA--DVIAATGWVVPALEVVGSRIEGWNIKFA-DTVADN 160 +EAEIA +DLP + ++ +V+ A V PA E+V +R G+ + +AD Sbjct: 93 IGMEAEIAYKFAKDLPPRAEPYSREEVLDAVESVHPAFEIVDTRFAGFGSQDGLSHMADQ 152 Query: 161 ASSGCFVLGGPARRIDGLDLRGATMRMSKNGEVVSSGSGGECLGNPLNAAVWLARTMAEF 220 + G V+G L+ + + +GE + G G P+ VW+A T A Sbjct: 153 FNHGALVVGPAIADWRSLEPLKERVALVVDGETKADTVAGNSAGEPVRLLVWMANTGAVS 212 Query: 221 GEPLKAGDIILTGALGPMVGVSAG 244 LKAGD++ TG+ V V AG Sbjct: 213 LGGLKAGDVVTTGSHVGTVMVPAG 236 Lambda K H 0.317 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 270 Length of database: 254 Length adjustment: 25 Effective length of query: 245 Effective length of database: 229 Effective search space: 56105 Effective search space used: 56105 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory