Align 3-carboxy-cis,cis-muconate cycloisomerase; EC 5.5.1.2; 3-carboxymuconate lactonizing enzyme; CMLE (uncharacterized)
to candidate AZOBR_RS28125 AZOBR_RS28125 3-carboxy-cis cis-muconate cycloisomerase
Query= curated2:Q9I6Q8 (459 letters) >FitnessBrowser__azobra:AZOBR_RS28125 Length = 453 Score = 384 bits (986), Expect = e-111 Identities = 217/445 (48%), Positives = 272/445 (61%), Gaps = 3/445 (0%) Query: 2 SDVPANQLFDAYFMAAPMRAVFSDRGRLQGMLDFEAALARAEARTGVVPATAVAPIEAAC 61 S + + +F F MRAV+SD R + LD EAALAR + R G++P A I A C Sbjct: 3 STIIDSAIFGDIFSTPAMRAVWSDENRTRKYLDIEAALARVQGRLGIIPQEAADEIVANC 62 Query: 62 RAELYDPLALAEAVATAGNSAIPLVKALGRQVAAGDAEAERYVHLGATSQDAMDSGLVLQ 121 + D L G + +V L A Y H GAT+QD D+ VLQ Sbjct: 63 SLDRIDMATLKAQTERIGYPVLGVVSQLN---ALCRDRLGEYCHWGATTQDITDTATVLQ 119 Query: 122 LRRALALLEQDLQRLAEVLADQAERHADTPLAGRTWLQHATPVTLGMKLAGLLGALTRHR 181 +R AL L+++DL L+ LA A+RH DTP+ GR+ LQ A PVT G K+AGLL A+ RHR Sbjct: 120 MREALNLVDEDLAGLSAALATLAKRHRDTPMIGRSNLQQAVPVTFGYKMAGLLSAVERHR 179 Query: 182 QRLRELRPRLLVLQFGGASGTLAALGEQALPVAAALAEELGLALPEQPWHTQRDRLVEFA 241 +RL +LRPR+L+ +F GASGTLA+L A+ A L EEL LA P WHT RD + E Sbjct: 180 ERLAQLRPRVLMGEFAGASGTLASLEHGAMETQAGLMEELDLAQPVIAWHTIRDTIAEVG 239 Query: 242 SVLGLVAGSLGKFGRDVSLLMQTEAGEVFEPAGAGRGGSSTMPHKRNPVSSAVLIAAATR 301 LGLV G+LGK DV L+MQTE GEV+EP GRG SSTMP KRNP+SS + A+ + Sbjct: 240 CFLGLVGGTLGKLSMDVKLMMQTEVGEVYEPFAHGRGSSSTMPQKRNPISSCYIHASISV 299 Query: 302 APGLVSTLFAAMPQEHERSLGLWHAEWETLPELCCLVAGALQQAIGLLEGLEVDAQRMRR 361 + L AM +HERS G W EW LPE CL+AGAL+QA ++ GLEVDA+RMR Sbjct: 300 LRQHTAALLDAMVADHERSTGPWEIEWIVLPEAFCLLAGALKQARFVVSGLEVDAERMRA 359 Query: 362 NLGLTHGLVLAEAVSIALARRIGREAAHHLVEQCCRRAVEQRRELRAVLGEEARVSAELS 421 NL +T+GLV +EAV + L R IGRE AH LV CR AV Q R L +L E +SA LS Sbjct: 360 NLEMTNGLVASEAVMMGLGRHIGREYAHDLVYDLCREAVRQNRPLLDLLAETPEISACLS 419 Query: 422 GDELDRLLDPAHYLGQARAWVERAL 446 EL +L DPA+YLGQ+ V+R L Sbjct: 420 RAELAKLCDPANYLGQSGVMVDRVL 444 Lambda K H 0.320 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 507 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 453 Length adjustment: 33 Effective length of query: 426 Effective length of database: 420 Effective search space: 178920 Effective search space used: 178920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate AZOBR_RS28125 AZOBR_RS28125 (3-carboxy-cis cis-muconate cycloisomerase)
to HMM TIGR02426 (pcaB: 3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02426.hmm # target sequence database: /tmp/gapView.25139.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02426 [M=338] Accession: TIGR02426 Description: protocat_pcaB: 3-carboxy-cis,cis-muconate cycloisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-112 359.9 2.9 7.5e-112 359.5 2.9 1.1 1 lcl|FitnessBrowser__azobra:AZOBR_RS28125 AZOBR_RS28125 3-carboxy-cis cis- Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS28125 AZOBR_RS28125 3-carboxy-cis cis-muconate cycloisomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 359.5 2.9 7.5e-112 7.5e-112 3 338 .] 12 350 .. 10 350 .. 0.98 Alignments for each domain: == domain 1 score: 359.5 bits; conditional E-value: 7.5e-112 TIGR02426 3 dglfgdseaaelfsdrarlramldvEaalaraqadvGlipaeaaeaiaaaaaelalDlealaeaaaeag 71 ++f+++++++++sd+ r r ld+Eaalar+q+++G+ip+eaa++i+a ++ ++D+++l++++++ g lcl|FitnessBrowser__azobra:AZOBR_RS28125 12 GDIFSTPAMRAVWSDENRTRKYLDIEAALARVQGRLGIIPQEAADEIVANCSLDRIDMATLKAQTERIG 80 689****************************************************************** PP TIGR02426 72 nvviplvkalrkavaeeaaryvHlGaTSQDviDTalmLqlrdaldllladlerlaeaLaelaarhrdtp 140 +v+++v +l++ + ++y H+GaT QD+ DTa++Lq+r+al+l+++dl+ l++aLa+la+rhrdtp lcl|FitnessBrowser__azobra:AZOBR_RS28125 81 YPVLGVVSQLNALCRDRLGEYCHWGATTQDITDTATVLQMREALNLVDEDLAGLSAALATLAKRHRDTP 149 ********************************************************************* PP TIGR02426 141 ltarTllQqAvpttvglkaagwlaavlrardrlealrtealalqfGGAaGtlaalekkglavaealAae 209 +++r lQqAvp+t+g k+ag l+av+r+r+rl++lr ++l +f GA+Gtla+le+ +++ ++ l +e lcl|FitnessBrowser__azobra:AZOBR_RS28125 150 MIGRSNLQQAVPVTFGYKMAGLLSAVERHRERLAQLRPRVLMGEFAGASGTLASLEHGAMETQAGLMEE 218 ********************************************************************* PP TIGR02426 210 lgLeapalpWhtqrdriaelaaaLalvagalgkiaqDvallaqtevgevle..agg.GGSSampHKrNP 275 l+L++p Wht rd+iae+++ L+lv g+lgk++ Dv l++qtevgev e a g G SS+mp KrNP lcl|FitnessBrowser__azobra:AZOBR_RS28125 219 LDLAQPVIAWHTIRDTIAEVGCFLGLVGGTLGKLSMDVKLMMQTEVGEVYEpfAHGrGSSSTMPQKRNP 287 ***************************************************87666899********** PP TIGR02426 276 vaaevlaaaarrapglvatLfaalaqedeRsaggWhaeWetLrelvaltagalrqaaellegl 338 + + + a + a+L++a+++ +eRs+g W++eW +L+e ++l agal+qa+ ++ gl lcl|FitnessBrowser__azobra:AZOBR_RS28125 288 ISSCYIHASISVLRQHTAALLDAMVADHERSTGPWEIEWIVLPEAFCLLAGALKQARFVVSGL 350 ********9999*********************************************999986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (338 nodes) Target sequences: 1 (453 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.45 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory