Align 3-oxoadipate enol-lactonase (EC 3.1.1.24); 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) (characterized)
to candidate AZOBR_RS05920 AZOBR_RS05920 3-oxoadipate enol-lactonase (Enol-lactone hydrolase) (Beta-ketoadipate enol-lactone hydrolase)
Query= BRENDA::Q0SH24 (400 letters) >FitnessBrowser__azobra:AZOBR_RS05920 Length = 259 Score = 181 bits (458), Expect = 3e-50 Identities = 100/230 (43%), Positives = 134/230 (58%), Gaps = 3/230 (1%) Query: 15 GAADAPVVVLLGSLGSNRSMWDPQIAALSYECRVVAVDQRGHGESPAPDGPYSVRDLSED 74 G D P V+LL SLG+N +WDPQ L+ RV+ D RGHG S AP GPY + DL++D Sbjct: 16 GPQDGPPVLLLHSLGTNHHVWDPQAEVLARRFRVIRPDMRGHGLSEAPPGPYGMEDLADD 75 Query: 75 VLALLDSLGVDAAHFVGLSMGGAIAQWLGAHAPRRVLSLSLLCTAAKFGEPQAWIERAAA 134 A+LD+LGV G+S+GG IAQ + AP RV L L+ T+ P W ERA Sbjct: 76 AFAVLDALGVGRCFVGGVSIGGMIAQTMALKAPHRVGGLVLVDTSMATAVPAMWRERAGQ 135 Query: 135 SRTDGPESLADAVVARWFSEGLAKRDPEFVRHYREMIASTSPEGYAACCDALADWDFTAD 194 R ADA+ ARW ++G A D ++ R M+ T+ EG+A C +ALA D +A Sbjct: 136 VRASSVAPFADAITARWVTQGFA--DSPEMQGLRTMLHQTAAEGFAGCAEALATADLSAR 193 Query: 195 LSRISAPTLVIAGEEDPSTPPSVMQILADGITEARFEVLSPAAHVANLEQ 244 + I+AP+LVI G++D STP + Q L + + VL AAH+ NLEQ Sbjct: 194 VGDIAAPSLVIVGDQDQSTPVAAAQALCAAL-KGTLVVLPDAAHIPNLEQ 242 Lambda K H 0.318 0.132 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 259 Length adjustment: 28 Effective length of query: 372 Effective length of database: 231 Effective search space: 85932 Effective search space used: 85932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory