Align ABC transporter for D-Alanine, periplasmic substrate-binding component (characterized)
to candidate AZOBR_RS00530 AZOBR_RS00530 putative amino-acid ABC transporter substrate-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5402 (343 letters) >FitnessBrowser__azobra:AZOBR_RS00530 Length = 349 Score = 258 bits (659), Expect = 2e-73 Identities = 138/339 (40%), Positives = 207/339 (61%), Gaps = 4/339 (1%) Query: 6 STLAVMTAAAVLGVSGFAQAGATLDAVQKKGFVQCGVSDGLPGFSVPDSTGKIVGIDADF 65 + +A + AAAV SG +A T++ V+++G ++CGVS G + D +G G D Sbjct: 11 AVVAAVLAAAVSAPSGGPRA-ETMEDVRERGLLRCGVSSSGAGLAAVDDSGNWRGFFVDM 69 Query: 66 CRAVAAAVFGDATKVKFSQLNAKERFTALQSGEIDMLSRNSTMTSSRDAGMGLKFPGFIT 125 CRA+AAAV G A +V+F + N++ RF L++GE+D++ +T T RDA G+ FP + Sbjct: 70 CRALAAAVAGKADRVEFVETNSENRFAILRNGEVDVVMEGTTWTLQRDATFGIDFPA-VY 128 Query: 126 YYDGIGFLANNKLGVKSAKELD-GATICIQAGTTTELNVSDYFRANGLKYTPITFDTSDE 184 +DG GF+A+ GV +L GA++C+ TTT N+ D+ G+++ +++ Sbjct: 129 LFDGQGFIAHRAHGVARLSDLPPGASVCVIEQTTTLRNLEDWMARTGVRFRLKRVRSTEG 188 Query: 185 SAKSLESGRCDVLTSDKSQLFAQRSKLASPKD-YVVLPETISKEPLGPVVRNGDDEWLAI 243 + + + CD+ TSD+ L AQR A +D YV+LPE ISKEPLGP+VR + W I Sbjct: 189 ALSAFFNHHCDLYTSDRIGLHAQRLLKAPERDDYVILPEAISKEPLGPMVRPDERRWFDI 248 Query: 244 VRWTGYALLNAEEAGVTSKNVEAEAKSTKNPDVARMLGADGEYGKDLKLPKDWVVQIVKQ 303 VRW A + AEE G+T+ N + ++P+V R+LGA G L L DW +++ Q Sbjct: 249 VRWVFLATVLAEEKGITAANAPRLKEEAQDPEVRRLLGATTGVGWGLGLDDDWAFRVITQ 308 Query: 304 VGNYGEMFERNLGKGTPLEIDRGLNALWNAGGIQYAPPV 342 VGNYGE+F+R+LG +PL IDRG+N LW GG+ YAPP+ Sbjct: 309 VGNYGEIFDRHLGAASPLGIDRGMNGLWMNGGLHYAPPL 347 Lambda K H 0.315 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 349 Length adjustment: 29 Effective length of query: 314 Effective length of database: 320 Effective search space: 100480 Effective search space used: 100480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory