Align ABC transporter for D-Alanine, permease component 2 (characterized)
to candidate AZOBR_RS26410 AZOBR_RS26410 amino acid ABC transporter permease
Query= reanno::pseudo6_N2E2:Pf6N2E2_5403 (375 letters) >FitnessBrowser__azobra:AZOBR_RS26410 Length = 216 Score = 88.2 bits (217), Expect = 2e-22 Identities = 64/187 (34%), Positives = 98/187 (52%), Gaps = 19/187 (10%) Query: 176 VAIVLMTRWANKRFEATGEPFHKFWVGLALFLVIPALSALLFGAPVHWEMPELKGFNFVG 235 + + LM A + T F L L +P L L+F ++ MP G Sbjct: 35 LGLALMRTSARRALRWTATAF------LQLVQGVPLLGLLMF---FYFGMPVFLG----- 80 Query: 236 GWVLIPELLALTLALTVYTAAFIAEIVRSGIKSVSHGQTEAARSLGLRNGPTLRKVIIPQ 295 V +P L+A+ +A+TVYTA+F+ EI R GI++V H Q EAA LGL R VI PQ Sbjct: 81 --VEMPPLVAVGIAMTVYTASFLGEIWRGGIEAVKHEQWEAAACLGLSTWHQFRYVIAPQ 138 Query: 296 ALRVIIPPLTSQYLNLAKNSSLAAGIGYPEMVSLFAGTVLN-QTGQAIEVIAITMSVYLA 354 A R+ +PP + L K +SLA+ +G+ E+ AG +++ T Q + V +I ++Y A Sbjct: 139 AFRMALPPTVGFLVQLIKGTSLASIVGFVELAR--AGQLVSAATFQPLLVYSIVAAIYFA 196 Query: 355 ISISISL 361 + ++L Sbjct: 197 ACLPLTL 203 Lambda K H 0.328 0.141 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 216 Length adjustment: 26 Effective length of query: 349 Effective length of database: 190 Effective search space: 66310 Effective search space used: 66310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory