Align D-lactate transporter, ATP-binding component (characterized)
to candidate AZOBR_RS29215 AZOBR_RS29215 amino acid ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >FitnessBrowser__azobra:AZOBR_RS29215 Length = 261 Score = 177 bits (448), Expect = 2e-49 Identities = 98/249 (39%), Positives = 143/249 (57%), Gaps = 4/249 (1%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 ILE + + K FGG A+ VNL VR T+HA+IGPNGAGKST+ N L L P G +++ Sbjct: 9 ILEARGLSKEFGGFIAVKGVNLRVRRGTIHALIGPNGAGKSTVFNLLTKFLTPTRGQILY 68 Query: 63 DGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVSGQ 122 G+ + P ++ +G+ R FQ +F LSVLEN+ + R +F A Sbjct: 69 KGRDITAMKPADVALLGMVRSFQISAVFPHLSVLENVRVALQRPRGTSFHFWKPEA--SL 126 Query: 123 RDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMARA 182 D+ ++AE ++E +N+ AA + G KR LEI L+ +P ++LLDEP AGM Sbjct: 127 HDLHDRAEELIEAVNLTPWAGHTAAELPYGRKRALEIATTLALDPEVMLLDEPLAGMGHE 186 Query: 183 DTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNPKV 242 D T L+K++ ++R TI ++EH++ VV L+D ITVL +G L E + NP+V Sbjct: 187 DIEGTAALIKRVSADR--TILMVEHNLSVVAHLSDTITVLRRGEILAEGAYDVVSRNPQV 244 Query: 243 REAYLGESA 251 EAY+G A Sbjct: 245 MEAYMGTGA 253 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 261 Length adjustment: 24 Effective length of query: 227 Effective length of database: 237 Effective search space: 53799 Effective search space used: 53799 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory