Align D-lactate transporter, permease component 2 (characterized)
to candidate AZOBR_RS04165 AZOBR_RS04165 ABC transporter permease
Query= reanno::Phaeo:GFF1250 (340 letters) >FitnessBrowser__azobra:AZOBR_RS04165 Length = 304 Score = 169 bits (428), Expect = 8e-47 Identities = 107/350 (30%), Positives = 173/350 (49%), Gaps = 69/350 (19%) Query: 1 MDAILL--QILNGLDKGSAYALIALGLTLIFGTLGVVNFAHGALFMIGAFCAVTVQRVLS 58 MDA+LL Q LNGL G L+A GLTL+FG + ++N AHG +M+GA+ + VL Sbjct: 1 MDALLLVEQGLNGLQLGVMLFLMAAGLTLVFGIMDLINLAHGTFYMVGAYLTAALVPVLG 60 Query: 59 LSFETVDETQKDFLGNPLKVKTPYVESWFGPEVGGAIIDWAVPLAILFAIPIMIGVGYVM 118 + PLA+ A+ + +G V+ Sbjct: 61 ----------------------------------------SFPLALAAAVLLTALLGLVV 80 Query: 119 ERGLIKHFYKRPHADQILVTFGLAIVLQEVVKYFYGANPIQTPAPDALNGVVNLGSIIGM 178 E ++ Y+R H DQ+L TFGL + E+VK +G PI P AL G V+L Sbjct: 81 EAVALRTLYRRDHLDQVLATFGLILFFNELVKIVFGPVPIFLNPPAALAGTVDL-----F 135 Query: 179 DIVYPVWRVVYFFFAVVIIGGIFSFLQFTTFGMVVRAGMADRETVGLLGINIDRRFTIMF 238 + YP +R+ + + ++ + T GM++RAG +RE V LG+++ R F ++F Sbjct: 136 GLKYPAFRLAILAVGIAVAVFLWLLIARTRVGMLIRAGATNREMVMALGVDVRRLFGLVF 195 Query: 239 GIAAAVAGLAGVMYTPINSPNYHMGMDFLVLSFVVVVVGGMGSLPGAVLAGFLLGVLESF 298 + +AGLAG M P+ + MG L+L+FVV+V+GG+GS+ GA+ L+G++++ Sbjct: 196 ALGCGLAGLAGAMAGPVLAVQVGMGEQILILTFVVIVIGGIGSIRGALAGALLVGMVDTL 255 Query: 299 ASMNEIKSLIPGIDQII-----------------IYVVAIIILLTRPRGL 331 ++L+P +++ IYV+ ++L RP+GL Sbjct: 256 G-----RALLPAAFRLVMDAANASAAGAALASMAIYVLMAVVLAIRPKGL 300 Lambda K H 0.329 0.147 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 340 Length of database: 304 Length adjustment: 28 Effective length of query: 312 Effective length of database: 276 Effective search space: 86112 Effective search space used: 86112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory