GapMind for catabolism of small carbon sources

 

Aligments for a candidate for DVU3033 in Azospirillum brasilense Sp245

Align Iron-sulfur cluster-binding protein (characterized, see rationale)
to candidate AZOBR_RS01620 AZOBR_RS01620 putative oxidoreductase subunit with NAD(P)-binding domain and ferridoxin-like domain

Query= uniprot:Q726S3
         (717 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS01620 AZOBR_RS01620 putative
           oxidoreductase subunit with NAD(P)-binding domain and
           ferridoxin-like domain
          Length = 478

 Score =  266 bits (681), Expect = 1e-75
 Identities = 166/435 (38%), Positives = 230/435 (52%), Gaps = 16/435 (3%)

Query: 36  ASRANAFKDIDEKAIIAEVADAKDHAAKNMDTLYAQFKAEAEKRGVKVHLARTAAEANEI 95
           A R   F+D+ ++       D K+H   N+DT    F+ +  ++G  VH  RT  EA + 
Sbjct: 40  ADRLPEFEDLRDQG-----RDLKNHVLANLDTYLEAFEGKVIEQGGHVHWCRTDQEARDA 94

Query: 96  IARIARDNNCKKAIKSKSMTAEETHLNHRLEEDNVEVIETDLGEWIIQMRHEGPSHMVMP 155
           I  I R    K   K KSM +EE  +N  LE + +  IETDLGE+IIQ+R E PSH++ P
Sbjct: 95  ILGICRKVGAKTVTKGKSMISEEIGINDYLEANGLTPIETDLGEYIIQLRREPPSHIIAP 154

Query: 156 AIHLSRYQVADLF----SEVTKQKQEVDIQRLVKVARRELRTHFATADMGISGANFAVAE 211
           A HLS+  V   F    +++   +   + + L+  AR+ LR  F  AD+GI+GAN  VAE
Sbjct: 155 AFHLSKADVEGTFRQAHTDLPADRVLDEPKVLIAEARQVLRRKFQQADVGITGANIMVAE 214

Query: 212 TGTIGLVTNEGNARLVTTLPRVHVALAGLDKLVPTLHDALRSLKVLPRNATGQAITSYVT 271
           TG+  +VTNEGN  L   LPRVHV +A +DK+VPTL DA   L++L R+ATGQ  ++Y T
Sbjct: 215 TGSTVIVTNEGNGDLTQILPRVHVVIATIDKVVPTLEDAALVLRLLARSATGQEASAYTT 274

Query: 272 WIGGANECEACVDGRKEMHIVFLDNGRRALAEDPLFSQVLRCVRCGACANVCPVYRLVGG 331
           +  G       +DG +E H+V LDNGR AL     F  VLRC+RCGAC N CPVY  VGG
Sbjct: 275 FSTGPRR-PGDLDGPEEFHVVLLDNGRSALLGTE-FQDVLRCIRCGACMNHCPVYGSVGG 332

Query: 332 HKMGHIYIGAIGLILTYFFHGRDKARNLVQNCINCESCKHICAGGIDLPRLIKEIRARLN 391
           H  G +Y G IG ++     G  +A +L      C  C+ +C   I LP++++  R +  
Sbjct: 333 HAYGWVYPGPIGSVMQPALLGVKEAGHLPNASTFCGRCEAVCPMRIPLPKMMRHWREKEF 392

Query: 392 EEEGMPVE----TTLMGKMLKNRKLFHTLLRFAKWAQKPVTGGTPYIRHLPQIFAKDHGF 447
           E+   P        L G   +   L+H   R A  A   +  G      LP         
Sbjct: 393 EQNLQPAAMRRGLALWGWFARRPALYHAATRMAVRALGALGRGKGRFASLPLAQGWTR-H 451

Query: 448 KALPAIADKPFRDEW 462
           + +PA   K F+  W
Sbjct: 452 RDMPAPEGKTFQQMW 466


Lambda     K      H
   0.321    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 731
Number of extensions: 45
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 717
Length of database: 478
Length adjustment: 37
Effective length of query: 680
Effective length of database: 441
Effective search space:   299880
Effective search space used:   299880
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory