Align L-lactate dehydrogenase iron-sulfur cluster-binding protein LldF (characterized, see rationale)
to candidate AZOBR_RS25110 AZOBR_RS25110 (Fe-S)-binding protein
Query= uniprot:Q8EGS5 (464 letters) >FitnessBrowser__azobra:AZOBR_RS25110 Length = 474 Score = 286 bits (731), Expect = 1e-81 Identities = 145/361 (40%), Positives = 216/361 (59%), Gaps = 12/361 (3%) Query: 39 LREKRDRAAGSLPEWEQLRQLGSEIKLHTLTNLAQYLETFEQNCLANGIKVHWAKDGAEH 98 L KR EW +R LG+ ++L L+ L + LE E NC NGI+VHWA E Sbjct: 32 LMSKRAVQFADTAEWNGVRTLGASVRLRALSKLPELLEKLEANCTKNGIQVHWASTTDEA 91 Query: 99 NRIVHEILASHKVKKLVKSKSMLTEECHLNPYLEQRGIEVIDTDLGERIIQLAKMPPSHI 158 N IV I+ K +VK KSM++EE HLN +LE+ GIE +++DLGE I+QL + PSHI Sbjct: 92 NAIVLSIMQRVNAKLVVKGKSMVSEEMHLNAFLEKHGIESLESDLGEYIVQLDEAMPSHI 151 Query: 159 VVPAIHMKKEEVGDLFHDKLGTKAGESDPLYLTRAARAHLREQFLSADAAMTGVNMAIAD 218 ++PAIHM +++ LF K+ D LT AR LR++F +AD ++GVNMA+A+ Sbjct: 152 IMPAIHMNTKQIAHLFKQKIKEAEYTEDVAQLTDLARRVLRKKFATADVGISGVNMAVAE 211 Query: 219 KGAVVVCTNEGNADMGANLPKLQLHSMGIDKVVPDIDSAAVLLRTLARNATGQPVTTYSA 278 G + + NEGN M +P + + MG++KVV ++ ++ L R+AT QP+TTY Sbjct: 212 TGTLCLVENEGNGRMSTTVPPVHIAVMGLEKVVEKLEDVPPVISLLTRSATAQPITTYVN 271 Query: 279 FYRGPQVDG------EMHVIIVDNGRTEMMKDKILAESLKCIRCGGCLNTCPVYRRSGGY 332 P+ +G E+H++I+DNGR+ + D+ L +L+CIRCG C+N CPVY + GG+ Sbjct: 272 MISSPRKEGEKDGPNEIHLVILDNGRSGIYADEELRNTLRCIRCGACMNHCPVYTKVGGH 331 Query: 333 SYNYTIPGPIGIAVGAT---HDNTNSIAWACTLCGSCTYVCPTKVPLDKIIHHHRRLKAE 389 +Y PGPIG + + + ACT+C +C +CP K+P+ +I+ RL++E Sbjct: 332 AYQAPYPGPIGSILMPQVEGLEKRGELPHACTMCNACVEICPVKIPIVEIM---GRLRSE 388 Query: 390 A 390 A Sbjct: 389 A 389 Lambda K H 0.320 0.134 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 510 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 464 Length of database: 474 Length adjustment: 33 Effective length of query: 431 Effective length of database: 441 Effective search space: 190071 Effective search space used: 190071 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory