Align ABC transporter for N-Acetyl-D-glucosamine, permease protein 2 (characterized)
to candidate AZOBR_RS27985 AZOBR_RS27985 ABC transporter permease
Query= reanno::Smeli:SMc02871 (279 letters) >FitnessBrowser__azobra:AZOBR_RS27985 Length = 280 Score = 127 bits (319), Expect = 3e-34 Identities = 82/267 (30%), Positives = 129/267 (48%), Gaps = 8/267 (2%) Query: 14 VHAALIAYTLIALFPVFLTIVNSFKSRNAIFREP-LAVPTPETFSLIGYETVLKQGDFIG 72 +HAA +A L+ LFP + + + +A+ + L +PT E F L QG F Sbjct: 20 LHAAALALLLLVLFPFAWMVQMALRPADAVLDDAVLFLPTLENF------VALWQGHFPK 73 Query: 73 YFQNSIIVTVVSIALVLLFGAMAAFALSEYRFRGNTLMGLYLALGIMIPIRLGTVAILQG 132 F NS++V+ +S A L G AA+ L+ +RFR + L++ M P T+ Sbjct: 74 SFLNSVLVSSLSTAASLALGVPAAYVLTRWRFRARRRVALWILATRMAPPIALTIPFFLA 133 Query: 133 MVATGLVNTLTALILVYTAQGLPLAVFILSEFMRTVSDDLKNAGRIDGLSEYAIFLRLVL 192 GL +++ L L+Y + + V+ + F + L+ A IDG + F R+ L Sbjct: 134 YRWVGLQDSVVGLALIYMTFNISIVVWFMQTFFAAIPRSLEEAAWIDGCGVWQAFRRVTL 193 Query: 193 PLIRPAMATVAVFTMIPIWNDLWFPLILAPAEATKTVTLGSQIFIGQFVTNWNAVLSALS 252 PL P +A AVF I WND +F LIL A T + F+ W + +A + Sbjct: 194 PLAAPGLAATAVFCFIFSWNDFFFALILTRTNAV-TAPVAITNFLQYEGWEWGKIAAAGT 252 Query: 253 LAIFPVLVLYVIFSRQLIRGITAGAVK 279 L + PVL ++ + L+RG+TAG +K Sbjct: 253 LVMLPVLAFTLLVRKYLVRGLTAGGLK 279 Lambda K H 0.330 0.142 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 280 Length adjustment: 26 Effective length of query: 253 Effective length of database: 254 Effective search space: 64262 Effective search space used: 64262 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory