GapMind for catabolism of small carbon sources

 

Aligments for a candidate for actP in Azospirillum brasilense Sp245

Align Acetate uptake permease, ActP1; also takes up tellurite (characterized)
to candidate AZOBR_RS19235 AZOBR_RS19235 actetate permease

Query= TCDB::D5AU53
         (551 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS19235 AZOBR_RS19235 actetate
           permease
          Length = 556

 Score =  788 bits (2035), Expect = 0.0
 Identities = 404/553 (73%), Positives = 464/553 (83%), Gaps = 8/553 (1%)

Query: 5   LLAAALAAM-----AGPALAAGEAIQGAVQQAPTNWTAIAMFLFFVVATLILTGWAARRT 59
           LLAAA AA+     AGP  AA  AI GAV++ P N TAIAMFL FV  TL +T WA++RT
Sbjct: 6   LLAAASAALLPVLVAGPVHAA--AIDGAVERQPVNVTAIAMFLLFVAGTLGITYWASKRT 63

Query: 60  KSTADFYTAGGGITGFQNGLAIAGDYMSAAAFLGISGMVFAKGVDGAIYTVGFTVGWPFI 119
           +S +DFYTAGGGI+GFQNGLAIAGDYMSAAAFLG+SGMVFAKG DG IYT+GF VGWP +
Sbjct: 64  RSASDFYTAGGGISGFQNGLAIAGDYMSAAAFLGLSGMVFAKGFDGVIYTIGFLVGWPLM 123

Query: 120 LFLIAERLRNLGKFTFADITSFRLEQTRIRTLSALGALTVVVFYLIAQMVGAGKLIQLLF 179
           LFLIAERLRNLG+FTFAD+ S+RL QT IR+L+A+G+LTVV FYLIAQMVGAGKLIQLLF
Sbjct: 124 LFLIAERLRNLGRFTFADVASYRLGQTPIRSLAAVGSLTVVCFYLIAQMVGAGKLIQLLF 183

Query: 180 GLPYSYAVILVGVLMVLYVTFGGMLATTWVQIVKAVMLLSGATLLVILGLAQFGFSPERL 239
           GL Y+YAV++VGVLM+LYVTFGGMLATTWVQI+KAVMLL G T+LV L LAQFGF+PERL
Sbjct: 184 GLDYTYAVVMVGVLMILYVTFGGMLATTWVQIIKAVMLLGGCTVLVGLALAQFGFNPERL 243

Query: 240 MADALANHAKGAAILEPTPLVTDWVSGVSLALALMFGPAGLPHILMRFFTVPDAKEARKS 299
           +  A+A HA  AAIL P+  + D ++ VSL+LALM GPAGLPHILMRFFTVPDAKEARKS
Sbjct: 244 LQQAVAAHAANAAILRPSAAMADPIAAVSLSLALMCGPAGLPHILMRFFTVPDAKEARKS 303

Query: 300 VFYATGFVAYFFVLTTTIGFLAITLVGKNPEFLDAKG-IIGGGNMAAIHLAQAVGGNIFL 358
           V YATGF+ YFF+LT TIGFLAI +VG NP +LDA G I+GGGNMAAIHL++A+GGN+FL
Sbjct: 304 VVYATGFIGYFFILTVTIGFLAIVIVGTNPAYLDAAGKILGGGNMAAIHLSKAIGGNLFL 363

Query: 359 GFISAVAFATILAVVSGLALSGASAVAHDLYANVVKKGAAADKAEMRVSRIATLVLGVLA 418
           GFISAVAFATILAVV+GL L+GASAV+HDLYA V+KKG A + +EMRVSR+ATL LGV+A
Sbjct: 364 GFISAVAFATILAVVAGLTLAGASAVSHDLYARVLKKGNATEASEMRVSRLATLALGVIA 423

Query: 419 IVLGLMFENQNIAFMVGLAFGLAASVNFPVLLLSIFWKGMTTRGAFIGGLIGLVVSIVLV 478
           I LGL+FENQNIAFMVGLAFGLAASVNFPVL+LSIFWKG+TTRGAFIGG  GLV  +  V
Sbjct: 424 ITLGLLFENQNIAFMVGLAFGLAASVNFPVLILSIFWKGLTTRGAFIGGFAGLVSCVAFV 483

Query: 479 VLGPAVWVDVFKFDTPIFPWSQYTLFSMATTFIAIWAFSVTDTSARAARDKAGYDAQFVR 538
           VLGP VWV VFKF  PIFP+    LFSM   F   W FSVTD SARAA +   Y+ Q++R
Sbjct: 484 VLGPTVWVSVFKFPAPIFPYEHPALFSMVIAFATTWLFSVTDRSARAAAEAKAYEYQYIR 543

Query: 539 SETGLGAAGAVAH 551
           SETGLGAA A +H
Sbjct: 544 SETGLGAASAASH 556


Lambda     K      H
   0.328    0.140    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 979
Number of extensions: 47
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 551
Length of database: 556
Length adjustment: 36
Effective length of query: 515
Effective length of database: 520
Effective search space:   267800
Effective search space used:   267800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory