GapMind for catabolism of small carbon sources

 

Aligments for a candidate for araVsh in Azospirillum brasilense Sp245

Align ABC transporter related (characterized, see rationale)
to candidate AZOBR_RS31210 AZOBR_RS31210 sugar ABC transporter ATP-binding protein

Query= uniprot:A0KWY5
         (499 letters)



>FitnessBrowser__azobra:AZOBR_RS31210
          Length = 516

 Score =  503 bits (1295), Expect = e-147
 Identities = 269/500 (53%), Positives = 345/500 (69%), Gaps = 11/500 (2%)

Query: 4   ILELKQISKHYPGVKALEDVSLRLFAGEVHALLGENGAGKSTLVKVMTGAQSKDMGDILF 63
           +L ++ +SK + GV+AL+ V   +  GE+HALLGENGAGKSTL+K +TG   +D G +  
Sbjct: 12  LLAIRGLSKAFLGVQALDGVDFTVRHGEIHALLGENGAGKSTLIKTLTGVYQRDAGTVTL 71

Query: 64  LGEPQHFNTPMDAQKAGISTVYQEVNLVPNLTVAQNLFLGYEPRRLGLIHFKKMYADARA 123
            G         +AQ+  I TVYQEVNL+PNL+VA+NLFLG +P R GL+    M   ARA
Sbjct: 72  EGRAIAPRGVEEAQRLHIGTVYQEVNLLPNLSVAENLFLGRQPMRFGLVDRGAMRRRARA 131

Query: 124 VLTQFKLDIDVSAPLSDYSIAVQQLIAIARGVAMSAKVLVLDEPTASLDAKEVQVLFGIL 183
           VL  + L +DV+APL  +S+A QQ++AIAR V MSAKVL+LDEPTASLDA+EV VLF ++
Sbjct: 132 VLIPYGLTLDVTAPLGRFSVATQQIVAIARAVDMSAKVLILDEPTASLDAQEVAVLFKVM 191

Query: 184 NQLKAKGVAIVFITHFLDQVYQISDRITVLRNGQFIGEYLTAELPQPKLIEAMLGRSLQE 243
             L+++G+ IVF+THFLDQVY + DRITVLRNG+ +GE  TAELP+  L+  MLGR L+ 
Sbjct: 192 RTLRSRGIGIVFVTHFLDQVYALCDRITVLRNGRLVGERRTAELPRLDLVAMMLGRELEA 251

Query: 244 QL------VDKQEKERTVTRAEAVLLSLEDVSVKGSIQSMNLTVPKGQAVGLAGLLGSGR 297
                    D  E++     A   L+         S++  +L +  G+ VGLAGLLGSGR
Sbjct: 252 VAHRIAPPADDAEED-----ARPPLVRFRGYGKARSVEPFDLDIRPGEVVGLAGLLGSGR 306

Query: 298 SEVCNAVFGLDLVDSGSIHLAGQKLNLSQPVDAISAGIALCPEDRKIDGIIGPLSIRENI 357
           +E    VFG+D  D G   + GQ + L  P DAI  G   CPEDRK +GI+G LS+RENI
Sbjct: 307 TETARLVFGMDRADRGEAAVDGQAVRLRGPRDAIRLGFGFCPEDRKKEGIVGALSVRENI 366

Query: 358 ILALQARIGWWRYLSNTRQQEIAQFFIDKLQIATPDADKPIEQLSGGNQQKVILARWLAI 417
           ILALQAR GW R +   RQ+EIA  FI  L I TP A++PI+ LSGGNQQK +LARWLA 
Sbjct: 367 ILALQARQGWLRPIPRCRQEEIADRFIRLLDIRTPHAEQPIQLLSGGNQQKALLARWLAT 426

Query: 418 EPILLVLDEPTRGIDIGAHAEIVKLIRTLCDEGMSLLVASSELDELVAFSNKVVVLRDRY 477
           EP LL+LDEPTRGID+GAHAEI++LI  LC +GM+LLV SSEL+E+VA+S +VVVLRDR 
Sbjct: 427 EPRLLILDEPTRGIDVGAHAEIIRLIERLCADGMALLVVSSELEEIVAYSRRVVVLRDRR 486

Query: 478 AVRELSGAELTSQHVMQAIA 497
            V EL G E+    ++ AIA
Sbjct: 487 HVAELRGGEVAVDRIVAAIA 506



 Score = 80.1 bits (196), Expect = 2e-19
 Identities = 56/239 (23%), Positives = 115/239 (48%), Gaps = 10/239 (4%)

Query: 14  YPGVKALEDVSLRLFAGEVHALLGENGAGKSTLVKVMTGAQSKDMGDILFLGEPQHFNTP 73
           Y   +++E   L +  GEV  L G  G+G++   +++ G    D G+    G+      P
Sbjct: 277 YGKARSVEPFDLDIRPGEVVGLAGLLGSGRTETARLVFGMDRADRGEAAVDGQAVRLRGP 336

Query: 74  MDAQKAGISTVYQE---VNLVPNLTVAQNLFLGYEPRRLGLIHFKKMYADARAVLTQFKL 130
            DA + G     ++     +V  L+V +N+ L  + R+  L    +   +   +  +F  
Sbjct: 337 RDAIRLGFGFCPEDRKKEGIVGALSVRENIILALQARQGWLRPIPRCRQEE--IADRFIR 394

Query: 131 DIDVSAPLSDYSIAV-----QQLIAIARGVAMSAKVLVLDEPTASLDAKEVQVLFGILNQ 185
            +D+  P ++  I +     QQ   +AR +A   ++L+LDEPT  +D      +  ++ +
Sbjct: 395 LLDIRTPHAEQPIQLLSGGNQQKALLARWLATEPRLLILDEPTRGIDVGAHAEIIRLIER 454

Query: 186 LKAKGVAIVFITHFLDQVYQISDRITVLRNGQFIGEYLTAELPQPKLIEAMLGRSLQEQ 244
           L A G+A++ ++  L+++   S R+ VLR+ + + E    E+   +++ A+   S+ E+
Sbjct: 455 LCADGMALLVVSSELEEIVAYSRRVVVLRDRRHVAELRGGEVAVDRIVAAIASESVPEE 513


Lambda     K      H
   0.319    0.136    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 694
Number of extensions: 26
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 499
Length of database: 516
Length adjustment: 34
Effective length of query: 465
Effective length of database: 482
Effective search space:   224130
Effective search space used:   224130
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory